spacer

EBI Dbfetch

ID   AJ564210; SV 2; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ564210;
XX
DT   27-MAY-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-DRB3 gene for MHC class II antigen, HLA-DR52
DE   allele, exon 2
XX
KW   HLA-DR52 allele; HLA-DRB3 gene; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Bengtsson M.;
RT   ;
RL   Submitted (23-MAY-2003) to the INSDC.
RL   Bengtsson M., Oncology, Radiology and Clin Immunology, Section of Clinical
RL   Immunology, Rudbeck Laboratory, University Hospital, S-751 85 Uppsala,
RL   SWEDEN.
XX
RN   [2]
RA   Perasaari J., Egle Jansson I., Partanen J., Bengtsson M.;
RT   "Description of a new DRB3* allele";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Bengtsson M.;
RT   ;
RL   Submitted (26-SEP-2003) to the INSDC.
RL   Bengtsson M., Oncology, Radiology and Clin Immunology, Section of Clinical
RL   Immunology, Rudbeck Laboratory, University Hospital, S-751 85 Uppsala,
RL   SWEDEN.
XX
DR   MD5; 6275719f2c6aa1168eefcf62b107952a.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230463; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
DR   Ensembl-Tr; ENST00000426847; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            1..270
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DR52"
FT                   /note="HLA-DRB3*01 variant"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA DRB3"
FT                   /allele="HLA-DR52"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="HLA-DRB3*01 variant"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*01:11"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="CAD91915.2"
FT                   /translation="RFLELRKSECHFFNGTERVRYLDIYFHNQEEFLRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DR52"
FT                   /number=2
FT                   /note="HLA-DRB3*01 variant"
XX
SQ   Sequence 270 BP; 56 A; 65 C; 98 G; 51 T; 0 other;
     cacgtttctt ggagctgcgt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga catatacttc cataaccagg aggagttcct gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer