spacer

EBI Dbfetch

ID   AJ563706; SV 1; linear; genomic DNA; STD; HUM; 1915 BP.
XX
AC   AJ563706;
XX
DT   21-MAY-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial MICB gene for MHC class I chain-related protein B,
DE   exons 2-5
XX
KW   MHC class I chain-related protein B; MICB gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1915
RA   Quiroga I.;
RT   ;
RL   Submitted (19-MAY-2003) to the INSDC.
RL   Quiroga I., Nuffiled Department of Surgery, University of Oxford, Tissue
RL   Typing Lab. Churchill Hospital, Old Road, Headington, Oxford, OX3 7LJ,
RL   UNITED KINGDOM.
XX
RN   [2]
RA   Quiroga I., Barnardo M., Sutton M., Sweeney D., Souto-Grando J.P.,
RA   Fuggle S.V.;
RT   "Novel MICB allele";
RL   Unpublished.
XX
RN   [3]
RA   Quiroga I.;
RT   "The role of MICA adn MICB in renal transplantation";
RL   Unpublished.
XX
DR   MD5; d893e652407aed77cf0d420aca0ee95d.
DR   Ensembl-Gn; ENSG00000204516; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206449; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224378; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227772; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231179; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234218; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238289; homo_sapiens.
DR   Ensembl-Tr; ENST00000427115; homo_sapiens.
DR   Ensembl-Tr; ENST00000428416; homo_sapiens.
DR   Ensembl-Tr; ENST00000443156; homo_sapiens.
DR   Ensembl-Tr; ENST00000546706; homo_sapiens.
DR   Ensembl-Tr; ENST00000547574; homo_sapiens.
DR   Ensembl-Tr; ENST00000549014; homo_sapiens.
DR   Ensembl-Tr; ENST00000551608; homo_sapiens.
DR   Ensembl-Tr; ENST00000551950; homo_sapiens.
DR   Ensembl-Tr; ENST00000551960; homo_sapiens.
DR   IMGT/LIGM; AJ563706.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1915
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="United Kingdom"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..255,527..814,1406..1684,1784..>1915)
FT                   /codon_start=1
FT                   /gene="MICB"
FT                   /product="MHC class I chain-related protein B"
FT                   /db_xref="GOA:Q29980"
FT                   /db_xref="HGNC:HGNC:7091"
FT                   /db_xref="IMGT/HLA:MICB*015"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1JE6"
FT                   /db_xref="PDB:2WY3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29980"
FT                   /protein_id="CAD91554.1"
FT                   /translation="EPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKP
FT                   QGQWAEDVLGAETWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSST
FT                   RGSRHFYYNGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQAD
FT                   CLQKLQRYLKSGVAIRRTVPPMVNVTCSKVSEGNITVTCRASSFYPRNITLTWRQDGVS
FT                   LSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHSTHPVPSGKALVLQ
FT                   SQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGP"
FT   exon            1..255
FT                   /gene="MICB"
FT                   /number=2
FT   intron          256..526
FT                   /gene="MICB"
FT                   /number=2
FT   exon            527..814
FT                   /gene="MICB"
FT                   /number=3
FT   intron          815..1405
FT                   /gene="MICB"
FT                   /number=3
FT   exon            1406..1684
FT                   /gene="MICB"
FT                   /number=4
FT   intron          1685..1783
FT                   /gene="MICB"
FT                   /number=4
FT   exon            1784..1915
FT                   /gene="MICB"
FT                   /number=5
XX
SQ   Sequence 1915 BP; 428 A; 509 C; 592 G; 386 T; 0 other;
     gagccccaca gtcttcgtta caacctcatg gtgctgtccc aggatggatc tgtgcagtca        60
     gggtttctcg ctgagggaca tctggatggt cagcccttcc tgcgctatga caggcagaaa       120
     cgcagggcaa agccccaggg acagtgggca gaagatgtcc tgggagctga gacctgggac       180
     acagagaccg aggacttgac agagaatggg caagacctca ggaggaccct gactcatatc       240
     aaggaccaga aaggaggtga gagtcggcag gggcaagagt aatgggaggc cttctccagg       300
     aaagttggag acagagagca gggacctgtc tcttcccgct ggatctggct gggggtgggg       360
     atgaggaata gggtcaggga ggctcagcag ggtggtgagc cggaactcag cccacacagg       420
     gaggcatgga ggagggccag ggaggggtcg ccgctgggct gagttcctca cttgggtgga       480
     aaggtgatgg gttcgggaat ggagaagtca ctgctgggtg ggggcaggct tgcattccct       540
     ccaggagatt agggtctgtg agatccatga agacagcagc accaggggct cccggcattt       600
     ctactacaat ggggagctct tcctctccca aaacctggag actcaagaat cgacagtgcc       660
     ccagtcctcc agagctcaga ccttggctat gaacgtcaca aatttctgga aggaagatgc       720
     catgaagacc aagacacact atcgcgctat gcaggcagac tgcctgcaga aactacagcg       780
     atatctgaaa tccggggtgg ccatcaggag aacaggtacc gaccctggcc aggggctcta       840
     ctgttcccgc aattctgcta gagttgcctc gcctcccagc tctgtccggg gaaaccctcc       900
     ctgtgctatg gatgcaggcg tttcctgttg gcatattgtg tcctgatttg cctctcctgt       960
     tagagccatt ggataaagac agtgggtctg ggactgaact gtccagtgtt gtaatctggg      1020
     aaagcagtgg gccctctgac agaagcctga gcctggggtg ggagttaggc aggagaggaa      1080
     gccctcaggg ccagggctgc cccctctgcc tcccggcctg cccatcccgg agagttccct      1140
     cctggcccca tgacccagga gtccaccctt gacatccccc tcctcagcat caatgtgggg      1200
     atcccagagc ctgaggccac agtcccaagg cccatcctcc tgctagcctg gaggaattag      1260
     gccccagggt gaggacagac ttacagaagg tccgggatct gtgagggatt cagccagagt      1320
     gagaacagtg gagaggagca gccctgttcc ctgcatctcc cttagagggg agcagggctt      1380
     cactggctct gccctttctt ctccagtgcc ccccatggtg aatgtcacct gcagcaaggt      1440
     ctcagagggc aacatcaccg tgacatgcag ggcttccagc ttctatcccc ggaatatcac      1500
     actgacctgg cgtcaggatg gggtatcttt gagccacaac acccagcagt ggggggatgt      1560
     cctgcctgat gggaatggaa cctaccagac ctgggtggcc accaggattc gccaaggaga      1620
     ggagcagagg ttcacctgct acatggaaca cagcgggaat cacagcactc accctgtgcc      1680
     ctctggtgag cctggggtga ccctggagag ggtcaggcca gggtaggaac agcagggacg      1740
     gctgtggctc tctgcccagt gtataacaag tccctttttt tcagggaagg cgctggtgct      1800
     tcagagtcaa cggacagact ttccatatgt ttctgctgct atgccatgtt ttgttattat      1860
     tattattctc tgtgtccctt gttgcaagaa gaaaacatca gcggcagagg gtcca           1915
//


spacer
spacer