spacer

EBI Dbfetch

ID   AJ563604; SV 1; linear; genomic DNA; STD; HUM; 267 BP.
XX
AC   AJ563604;
XX
DT   16-JUN-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*0401 new
DE   allele, exon 2
XX
KW   HLA-DPB1 gene; human leucocyte antigen DPB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-267
RA   Cox S.;
RT   ;
RL   Submitted (16-MAY-2003) to the INSDC.
RL   Cox S., HLA Sequencing, Anthony Nolan Research Institute, The Royal Free
RL   Hospital, Pond St., Hampstead, LONDON, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T., Wallis-Jones S.;
RT   "Two new HLA DP alleles";
RL   Unpublished.
XX
DR   MD5; 62fd2fdb830a2fa3d01d2bd62908c914.
XX
CC   Related entry X72072
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..267
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..267
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0401 new"
FT                   /number=2
FT   CDS             <1..>267
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0401 new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q7YQ09"
FT                   /db_xref="IMGT/HLA:DPB1*04:01:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YQ09"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAD91640.1"
FT                   /translation="ENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVT
FT                   ELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRR"
FT   variation       200
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0401"
FT                   /replace="g"
XX
SQ   Sequence 267 BP; 61 A; 68 C; 97 G; 41 T; 0 other;
     cagagaatta ccttttccag ggacggcagg aatgctacgc gtttaatggg acacagcgct        60
     tcctggagag atacatctac aaccgggagg agttcgcgcg cttcgacagc gacgtggggg       120
     agttccgggc ggtgacggag ctggggcggc ctgctgcgga gtactggaac agccagaagg       180
     acatcctgga ggagaagcgt gcagtgccgg acaggatgtg cagacacaac tacgagctgg       240
     gcgggcccat gaccctgcag cgccgag                                           267
//


spacer
spacer