spacer

EBI Dbfetch

ID   AJ563603; SV 1; linear; genomic DNA; STD; HUM; 267 BP.
XX
AC   AJ563603;
XX
DT   16-JUN-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*1701 new
DE   allele, exon 2
XX
KW   HLA-DPB1 gene; human leucocyte antigen DPB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-267
RA   Cox S.;
RT   ;
RL   Submitted (16-MAY-2003) to the INSDC.
RL   Cox S., HLA Sequencing, Anthony Nolan Research Institute, The Royal Free
RL   Hospital, Pond St., Hampstead, LONDON, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T., Wallis-Jones S.;
RT   "Two new HLA DP alleles";
RL   Unpublished.
XX
DR   MD5; b8643b290709081d55c767ab0481fa39.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
CC   Related entry X72082
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..267
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..267
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1701 new"
FT                   /number=2
FT   CDS             <1..>267
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1701 new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*98:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /protein_id="CAD91639.1"
FT                   /translation="ENYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVT
FT                   ELGRPDEDYWNSQKDILEEKRAVPDRMCRHNYELDEAVTLQRR"
FT   variation       195
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1701"
FT                   /replace="g"
XX
SQ   Sequence 267 BP; 65 A; 65 C; 97 G; 40 T; 0 other;
     cagagaatta cgtgcaccag ttacggcagg aatgctacgc gtttaatggg acacagcgct        60
     tcctggagag atacatctac aaccgggagg agttcgtgcg cttcgacagc gacgtggggg       120
     agttccgggc ggtgacggag ctggggcggc ctgatgagga ctactggaac agccagaagg       180
     acatcctgga ggagaagcgg gcagtgccgg acaggatgtg cagacacaac tacgagctgg       240
     acgaggccgt gaccctgcag cgccgag                                           267
//


spacer
spacer