spacer

EBI Dbfetch

ID   AJ563426; SV 1; linear; genomic DNA; STD; HUM; 1684 BP.
XX
AC   AJ563426;
XX
DT   16-MAY-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial MICA gene for MHC class I chain-related protein A,
DE   exons 2-4
XX
KW   MHC class I chain-related protein A; MICA gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1684
RA   Quiroga I.;
RT   ;
RL   Submitted (14-MAY-2003) to the INSDC.
RL   Quiroga I., Nuffield Department of Surgery, University of Oxford, Tissie
RL   Typing Laboratory, Churchill Hospital, Old Road, Headington, Oxford, OXON,
RL   OX3 7LJ, UNITED KINGDOM.
XX
RN   [2]
RA   Quiroga I., Barnardo M., Sutton M., Sweeney D., Souto-Grando J.P.,
RA   Fuggle S.V.;
RT   "New MICA allele";
RL   Unpublished.
XX
RN   [3]
RA   Quiroga I.;
RT   "The Role of MICA and MICB in Renal Transplantation";
RL   Unpublished.
XX
DR   MD5; 84234aae43af443f917ff75a3d17c1e4.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AJ563426.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1684
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="United Kingdom"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..256,531..818,1406..1684)
FT                   /gene="MICA"
FT   CDS             join(<1..256,531..818,1406..>1684)
FT                   /codon_start=1
FT                   /gene="MICA"
FT                   /product="MHC class I chain-related protein A"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="IMGT/HLA:MICA*051"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /protein_id="CAD91415.1"
FT                   /translation="EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKP
FT                   QGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNST
FT                   RSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHAD
FT                   CLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVS
FT                   LSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPS"
FT   exon            1..256
FT                   /gene="MICA"
FT                   /number=2
FT   intron          257..530
FT                   /gene="MICA"
FT                   /number=2
FT   exon            531..818
FT                   /gene="MICA"
FT                   /number=3
FT   intron          819..1405
FT                   /gene="MICA"
FT                   /number=3
FT   exon            1406..1684
FT                   /gene="MICA"
FT                   /number=4
XX
SQ   Sequence 1684 BP; 391 A; 457 C; 511 G; 325 T; 0 other;
     gagccccaca gtcttcgtta taacctcacg gtgctgtcct gggatggatc tgtgcagtca        60
     gggtttcttg ctgaggtaca tctggatggt cagcccttcc tgcgctatga caggcagaaa       120
     tgcagggcaa agccccaggg acagtgggca gaagatgtcc tgggaaataa gacatgggac       180
     agagagacca gggacttgac agggaacgga aaggacctca ggatgaccct ggctcatatc       240
     aaggaccaga aagaaggtga gagtcggcag gggcaagagt gactggagag gccttttcca       300
     gaaaagttag gggcagagag cggggacctg tatctaccca ctggatctgg ctcaggctgg       360
     gggtgaggaa tgggggtcag tggaactcag cagggaggtg agccggcact cagcccacac       420
     agggaggcat ggaggagggc cagggaggcg taccccctgg gctgagttcc tcacttgggt       480
     ggaaaggtga tgggttcggg aatggagaag tcactgctgg gtgggggcag gcttgcattc       540
     cctccaggag attagggtct gtgagatcca tgaagacaac agcaccagga gctcccagca       600
     tttctactac gatggggagc tcttcctctc ccaaaacctg gagactgagg aatggacaat       660
     gccccagtcc tccagagctc agaccttggc catgaacgtc aggaatttct tgaaggaaga       720
     tgccatgaag accaagacac actatcacgc tatgcatgca gactgcctgc aggaactacg       780
     gcgatatcta aaatccggcg tagtcctgag gagaacaggt acggacgctg gccaggggct       840
     ctcctctccc tccaattctg ctagagttgc ctcacctccc agatgtgtcc agggaaaccc       900
     tccctgtgct atggatgaag gcatttcctg ttggcacatc gtgtcctgat tttcctctat       960
     tgttagagcc actggataaa gacagtgggt cagggactgg accatccagt gttgtaatca      1020
     gggcaagtag aggaccctcc gacagaatcc tgagcctgtg gtgggtgtca ggcaggagag      1080
     gaaggcttca gggccagggc tgccccctct gcctcccagc ctgcccatcc tggagagttc      1140
     cctcctggcc ccacaaccca ggagtccacc cctgacatcc ccctcctcag catcaatgtg      1200
     gggatcccag agcctgaggc cacagtccca tggcccatcc tcctgccagc ctggaagaac      1260
     tgggccccag agtgaggaca gacttgcagg tcaggggtcc cagagggctt cagccagagt      1320
     gagaacagtg aagagaaaca gccctgttcc tctcccctcc ttagagggga gcagggcttc      1380
     actggctctg ccctttcttc tccagtgccc cccatggtga atgtcacccg cagtgaggcc      1440
     tcagagggca acattaccgt gacatgcagg gcttctggct tctatccctg gaatatcaca      1500
     ctgagctggc gtcaggatgg ggtatctttg agccacgaca cccagcagtg gggggatgtc      1560
     ctgcctgatg ggaatggaac ctaccagacc tgggtggcca ccaggatttg ccaaggagag      1620
     gagcagaggt tcacctgcta catggaacac agcgggaatc acagcactca ccctgtgccc      1680
     tctg                                                                   1684
//


spacer
spacer