Dbfetch

ID   AJ558132; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ558132;
XX
DT   15-JAN-2004 (Rel. 78, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*1701new
DE   allele, exon 3
XX
KW   HLA-C gene; HLA-Cw*1701new allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Blasczyk R.;
RT   ;
RL   Submitted (01-MAY-2003) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2004.00165.x.
RX   PUBMED; 14705982.
RA   Elsner H.A., Blasczyk R.;
RT   "The phylogenies of introns 4-7 demonstrate an inconsistent pattern between
RT   human leukocyte antigen-C group topologies";
RL   Tissue Antigens 63(2):109-121(2004).
XX
DR   MD5; 523218765aceb724e763c40a60c0fc93.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="98807B"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*1701new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:C*17:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q70NZ9"
FT                   /protein_id="CAD90012.1"
FT                   /translation="SHTIQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAA
FT                   DTAAQISQRKLEAAREAEQLRAYLEGECVEWLRGYLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*1701new"
FT                   /product="MHC class I antigen"
FT                   /number='3'
XX
SQ   Sequence 276 BP; 52 A; 84 C; 101 G; 39 T; 0 other;
     gttctcacac catccagagg atgtatggct gcgacctggg gcccgacggg cgcctcctcc        60
     gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgcggcggac acggcggctc agatctccca gcgcaagttg gaggcggccc       180
     gtgaggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg ctccgcggat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//