Dbfetch

ID   AJ558131; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ558131;
XX
DT   15-JAN-2004 (Rel. 78, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*1701new
DE   allele, exon 2
XX
KW   HLA-C gene; HLA-Cw*1701new allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Blasczyk R.;
RT   ;
RL   Submitted (01-MAY-2003) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2004.00165.x.
RX   PUBMED; 14705982.
RA   Elsner H.A., Blasczyk R.;
RT   "The phylogenies of introns 4-7 demonstrate an inconsistent pattern between
RT   human leukocyte antigen-C group topologies";
RL   Tissue Antigens 63(2):109-121(2004).
XX
DR   MD5; c25f7d462990b80179b3b216a9e3e2f4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="98807B"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*1701new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:C*17:01:01:01"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q70P00"
FT                   /protein_id="CAD90011.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*1701new"
FT                   /product="MHC class I antigen"
FT                   /number='2'
XX
SQ   Sequence 270 BP; 54 A; 83 C; 99 G; 34 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//