Dbfetch

ID   AJ558129; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ558129;
XX
DT   15-JAN-2004 (Rel. 78, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*140201new
DE   allele, exon 3
XX
KW   HLA-C gene; HLA-Cw*140201new allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Blasczyk R.;
RT   ;
RL   Submitted (01-MAY-2003) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2004.00165.x.
RX   PUBMED; 14705982.
RA   Elsner H.A., Blasczyk R.;
RT   "The phylogenies of introns 4-7 demonstrate an inconsistent pattern between
RT   human leukocyte antigen-C group topologies";
RL   Tissue Antigens 63(2):109-121(2004).
XX
DR   MD5; 1cf123416310e3a5e55f1e4b48ca071f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="MHH 990558"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*140201new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:C*14:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q70P02"
FT                   /protein_id="CAD90009.1"
FT                   /translation="SHTLQWMFGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAA
FT                   DTAAQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*140201new"
FT                   /product="MHC class I antigen"
FT                   /number='3'
XX
SQ   Sequence 276 BP; 50 A; 87 C; 102 G; 37 T; 0 other;
     ggtctcacac cctccagtgg atgtttggct gcgacctggg gcccgacggg cgcctcctcc        60
     gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac gaggatctgc       120
     gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//