spacer

EBI Dbfetch

ID   AJ558103; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   AJ558103;
XX
DT   01-MAY-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*07new
DE   allele, exons 2-3
XX
KW   HLA-B gene; HLA-B*07new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RA   Witter K.;
RT   ;
RL   Submitted (30-APR-2003) to the INSDC.
RL   Witter K., Laboratory of Immunogenetics, University of Munich, Paul-Heyse
RL   Strasse 33, 80336 Munich, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2005.00390.x.
RX   PUBMED; 15853907.
RA   Witter K., Volgger A., Zahn R., Scholz S., Albert E.D.;
RT   "Bone marrow donor routine HLA typing identified a novel B*07 allele,
RT   B*0734, confirmed by allele-specific DNA cycle sequencing";
RL   Tissue Antigens 65(5):497-499(2005).
XX
DR   MD5; ffd89500d818e148331f4f1db8e8b54f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /isolate="121036"
FT                   /mol_type="genomic DNA"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,517..>792)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q860E0"
FT                   /db_xref="IMGT/HLA:B*07:34"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q860E0"
FT                   /protein_id="CAD89997.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGTC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /number=2
FT   intron          271..516
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /number=2
FT   exon            517..792
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /number=3
XX
SQ   Sequence 792 BP; 143 A; 264 C; 282 G; 103 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggact gggctgaacc gcggggccgg ggccagggtc tcacaccctc cagagcatgt       540
     acggctgcga cgtggggccg gacgggcgcc tcctccgcgg gcataaccag tacgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ctggaccgcc gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag ctgagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggacaagc       780
     tggagcgcgc tg                                                           792
//


spacer
spacer