Dbfetch

ID   AJ557776; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ557776;
XX
DT   28-APR-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-DQB1 gene for MHC class II antigen, HLA-DQB1* variant,
DE   exon 2
XX
KW   HLA-DQB1 gene; HLA-DQB1* variant; human leucocyte antigen DQB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Velickovic Z.M.;
RT   ;
RL   Submitted (28-APR-2003) to the INSDC.
RL   Velickovic Z.M., Tissue Typing, Australian Red Cross Blood Service, 153
RL   Clarence Street, Sydney, NSW, 2000, AUSTRALIA.
XX
RN   [2]
RA   Velickovic Z.M.;
RT   "A novel HLA-DQB1 allele";
RL   Unpublished.
XX
DR   MD5; abbb8b0df876add61daf6000a8543c01.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1* variant"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q860H9"
FT                   /db_xref="IMGT/HLA:DQB1*03:05:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q860H9"
FT                   /protein_id="CAD89801.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRGVTRYIYNREEYARFDSDVGVYRAV
FT                   TPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1* variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 71 C; 96 G; 44 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacc gagcgcgtgc        60
     ggggtgtgac cagatacatc tataaccgag aggagtacgc acgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgctggggc cgcctgccgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacacggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag                                        270
//