Dbfetch

ID   AJ557018; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ557018;
XX
DT   18-OCT-2003 (Rel. 77, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*5515 allele, exon 2
DE   and joined CDS
XX
KW   HLA-B gene; HLA-B*5515 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Binder T.M.C.;
RT   ;
RL   Submitted (18-APR-2003) to the INSDC.
RL   Binder T.M.C., HLA Laboratory, Transfusion Medicine, Martinistrasse 52,
RL   D-20246 Hamburg, GERMANY.
XX
RN   [2]
RA   Binder T.M.C., Loeliger C.C., Blasczyk R., Eiermann T.H.;
RT   "A new HLA-B*5501 like HLA molecule, found in a Caucasian potential stem
RT   cell donor";
RL   Unpublished.
XX
DR   MD5; 396420fda6ff3eab13f333b339f9070f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany:Hamburg"
FT                   /sex="female"
FT                   /tissue_type="B-lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ557019.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5515"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="Internal name: HLA-B*55AHU"
FT                   /db_xref="GOA:Q70PJ0"
FT                   /db_xref="IMGT/HLA:B*55:15"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q70PJ0"
FT                   /protein_id="CAD89529.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDRDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTWQTMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5515"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 84 C; 93 G; 34 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agagacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//