spacer

EBI Dbfetch

ID   AJ556171; SV 1; linear; genomic DNA; STD; HUM; 1110 BP.
XX
AC   AJ556171;
XX
DT   14-APR-2004 (Rel. 79, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*0707 allele
XX
KW   HLA-B gene; HLA-B*0707 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1110
RA   Vilches C.;
RT   ;
RL   Submitted (14-APR-2003) to the INSDC.
RL   Vilches C., Inmunologia, H.U. Puerta de Hierro, 4 San Martin de Porres,
RL   28035, SPAIN.
XX
RN   [3]
RX   DOI; 10.1111/j.1399-0039.2005.00407.x.
RX   PUBMED; 15896200.
RA   Vilches C., Sepulveda S., Balas A., Solis R., Aviles M.J., Estefania E.,
RA   Gomez-Lozano N., Vicario J.L., DePablo R.;
RT   "Complete coding sequences and haplotypic associations of HLA-B*0707,
RT   -B*1524, -B*4405, -B*4802, -DRB1*0409, -DRB1*0411, -DRB1*1115, -DRB1*1305,
RT   and the novel allele -DRB1*0709. Group-specific amplification of cDNA from
RT   DRB1 alleles associated to DRB3 and DRB4";
RL   Tissue Antigens 65(6):529-538(2005).
XX
DR   MD5; 49ef2eb118a086a00380aa5754c191f5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1110
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Venezuela"
FT                   /cell_line="C211"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             5..1093
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0707"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q546C9"
FT                   /db_xref="IMGT/HLA:B*07:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q546C9"
FT                   /protein_id="CAD89001.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   sig_peptide     5..76
FT                   /gene="HLA-B"
FT   mat_peptide     77..1090
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
XX
SQ   Sequence 1110 BP; 225 A; 338 C; 372 G; 175 T; 0 other;
     cgagatgctg gtcatggcgc cccgaaccgt cctcctgctg ctctcggcgg ccctggccct        60
     gaccgagacc tgggccggct cccactccat gaggtatttc tacacctccg tgtcccggcc       120
     cggccgcggg gagccccgct tcatctcagt gggctacgtg gacgacaccc agttcgtgag       180
     gttcgacagc gacgccgcga gtccgagaga ggagccgcgg gcgccgtgga tagagcagga       240
     ggggccggag tattgggacc ggaacacaca gatctacaag gcccaggcac agactgaccg       300
     agagagcctg cggaacctgc gcggctacta caaccagagc gaggccgggt ctcacaccct       360
     ccagaggatg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg ggcatgacca       420
     gtacgcctac gacggcaagg attacatcgc cctgaacgag gacctgcgct cctggaccgc       480
     cgcggacacg gcggctcaga tcacccagcg caagtgggag gcggcccgtg aggcggagca       540
     gcggagagcc tacctggagg gcgagtgcgt ggagtggctc cgcagatacc tggagaacgg       600
     gaaggacaag ctggagcgcg ctgacccccc aaagacacac gtgacccacc accccatctc       660
     tgaccatgag gccaccctga ggtgctgggc cctgggtttc taccctgcgg agatcacact       720
     gacctggcag cgggatggcg aggaccaaac tcaggacact gagcttgtgg agaccagacc       780
     agcaggagat agaaccttcc agaagtgggc agctgtggtg gtgccttctg gagaagagca       840
     gagatacaca tgccatgtac agcatgaggg gctgccgaag cccctcaccc tgagatggga       900
     gccgtcttcc cagtccaccg tccccatcgt gggcattgtt gctggcctgg ctgtcctagc       960
     agttgtggtc atcggagctg tggtcgctgc tgtgatgtgt aggaggaaga gttcaggtgg      1020
     aaaaggaggg agctactctc aggctgcgtg cagcgacagt gcccagggct ctgatgtgtc      1080
     tctcacagct tgaaaagcct gagacagctg                                       1110
//


spacer
spacer