spacer

EBI Dbfetch

ID   AJ556167; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   AJ556167;
XX
DT   14-APR-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*KW11_4_3_new
DE   allele, exons 1-2
XX
KW   HLA-B gene; HLA-B*KW11_4_3_new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Witter K.;
RT   ;
RL   Submitted (11-APR-2003) to the INSDC.
RL   Witter K., Laboratory of Immunogenetics, University of Munich, Paul-Heyse
RL   Strasse 33, 80336 Munich, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2005.00393.x.
RX   PUBMED; 15853908.
RA   Witter K., Zahn R., McNicholas A., Volgger A., Albert E.D.;
RT   "A novel HLA-B*55 allele, HLA-B*5514, found in a DNA sample derived from a
RT   bone marrow donor";
RL   Tissue Antigens 65(5):500-502(2005).
XX
DR   MD5; 2bbc71f052fc6371261b6ed175724774.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /isolate="donor 117562"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*KW11_4_3_new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q860Q1"
FT                   /db_xref="IMGT/HLA:B*55:14"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q860Q1"
FT                   /protein_id="CAD88897.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHIIQVMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*KW11_4_3_new"
FT                   /number=1
FT   intron          271..515
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*KW11_4_3_new"
FT                   /number=1
FT   exon            516..791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*KW11_4_3_new"
FT                   /number=2
XX
SQ   Sequence 791 BP; 141 A; 260 C; 288 G; 102 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggacg gggctgaccg cggggccggg gccagggtct cacatcatcc aggtgatgta       540
     tggctgcgac gtggggccgg acgggcgcct cctccgcggg catgaccagt ccgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacaccgc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagc tgagagccta       720
     cctggagggc acgtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg g                                                            791
//


spacer
spacer