spacer

EBI Dbfetch

ID   AJ555413; SV 1; linear; genomic DNA; STD; HUM; 3110 BP.
XX
AC   AJ555413;
XX
DT   03-JUN-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, HLA-A*3201 allele, exons
DE   1-8
XX
KW   HLA-A gene; HLA-A*3201 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3110
RA   Cox S.T.;
RT   ;
RL   Submitted (03-APR-2003) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Confirmation of HLA-A*3201";
RL   Unpublished.
XX
DR   MD5; 65ac6d0bacaf80c7ff18365db456a8eb.
DR   Ensembl-Gn; ENSG00000223980; homo_sapiens.
DR   Ensembl-Tr; ENST00000454091; homo_sapiens.
DR   Ensembl-Tr; ENST00000552493; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3110
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="AM"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,203..472,714..989,1590..1865,1965..2081,
FT                   2522..2554,2697..2744,2914..2918)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3201"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5RJ27"
FT                   /db_xref="IMGT/HLA:A*32:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5RJ27"
FT                   /protein_id="CAD87772.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAHSQTDRESLRI
FT                   ALRYYNQSEAGSHTIQMMYGCDVGPDGRLLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAMFAGAVVAAVRWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   exon            <1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3201"
FT                   /number=1
FT   intron          74..202
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3201"
FT                   /number=1
FT   exon            203..472
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3201"
FT                   /number=2
FT   intron          473..713
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3201"
FT                   /number=2
FT   exon            714..989
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3201"
FT                   /number=3
FT   intron          990..1589
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3201"
FT                   /number=3
FT   exon            1590..1865
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3201"
FT                   /number=4
FT   intron          1866..1964
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3201"
FT                   /number=4
FT   exon            1965..2081
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3201"
FT                   /number=5
FT   intron          2082..2521
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3201"
FT                   /number=5
FT   exon            2522..2554
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3201"
FT                   /number=6
FT   intron          2555..2696
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3201"
FT                   /number=6
FT   exon            2697..2744
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3201"
FT                   /number=7
FT   intron          2745..2913
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3201"
FT                   /number=7
FT   exon            2914..2918
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3201"
FT                   /number=8
XX
SQ   Sequence 3110 BP; 592 A; 889 C; 959 G; 670 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct tgggggccct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcgtg gggaaaccgc ctctgcgggg agaagcaagg       120
     ggcccgcccg gcgggggcgc aggacccggg tagccgcgcc gggaggaggg tcgggcgggt       180
     ctcagccact cctcgccccc aggctcccac tccatgaggt atttcttcac atccgtgtcc       240
     cggcccggcc gcggggagcc ccgcttcatc gccgtgggct acgtggacga cacgcagttc       300
     gtgcggtttg acagcgacgc cgcgagccag aggatggagc cgcgggcgcc gtggatagag       360
     caggaggggc cggagtattg ggaccaggag acacggaatg tgaaggccca ctcacagact       420
     gaccgagaga gcctgcggat cgcgctccgc tactacaacc agagcgaggc cggtgagtga       480
     ccccggcccg gggcgcaggt cacgacctct catcccccac ggacgggcca ggtcgcccac       540
     agtctccggg tccgagatcc accccgaagc cgcgggaccc cgagaccctt gccccgggag       600
     aggcccaggc gcctttaccc ggtttcattt tcagtttagg ccaaaaatcc ccccgggttg       660
     gtcggggccg gacggggctc gggggactgg gctgaccgtg gggtcggggc caggttctca       720
     caccatccag atgatgtatg gctgcgacgt ggggccggac gggcgcctcc tccgcgggta       780
     ccagcaggac gcctacgacg gcaaggatta catcgccttg aacgaggacc tgcgctcttg       840
     gaccgcggcg gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc       900
     ggagcagttg agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga       960
     gaacgggaag gagacgctgc agcgcacggg taccaggggc cacggggcgc ctccctgatc      1020
     gcctgtagat ctcccgggct ggcctcccac aaggagggga gacaattggg accaacacta      1080
     gaatatcgcc ctccctctgg tcctgaggga gaggaatcct cctgggtttc cagatcctgt      1140
     accagagagt gactctgagg ttccgccctg ctctctgaca caattaaggg ataaaatctc      1200
     tgaaggaatg acgggaagac gatccctcga atactgatga gtggttccct ttgacacaca      1260
     ccggcagcag ccttgggccc gtgacttttc ctctcaggcc ttgttctctg cttcacactc      1320
     aatgtgtgtg ggggtctgag tccagcactt ctgagtccct cagcctccac tcaggtcagg      1380
     accagaagtc gctgttccct cttcagggac tagaattttc cacggaatag gagattatcc      1440
     caggtgcctg tgtccaggct ggtgtctggg ttctgtgctc ccttccccat cccaggtgtc      1500
     ctgtccattc tcaagatagc cacatgtgtg ctggaggagt gtcccatgac agatgcaaaa      1560
     tgcctgaatg ttctgactct tcctgacaga cgcccccaag acgcatatga ctcaccacgc      1620
     tgtctctgac catgaggcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat      1680
     cacactgacc tggcagcggg atggggagga ccagacccag gacacggagc ttgtggagac      1740
     caggcctgca ggggatggaa ccttccagaa gtgggcgtct gtggtggtgc cttctggaca      1800
     ggagcagaga tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag      1860
     atggggtaag gagggagatg ggggtgtcat gtcttttacg gaaagcagga gcctctctga      1920
     cctttagcag ggtcagggcc cctcaccttc ccctcttttc ccagagccgt cttcccagcc      1980
     caccatcccc atcgtgggca tcattgctgg cctagttctc tttggagcta tgttcgctgg      2040
     agctgtggtc gctgctgtga ggtggaggag gaagagctca ggtggggtga agggatgaag      2100
     ggtgggtctg agatttcttg tctcactgag ggttccaaga cccaggtaga agtgtgccct      2160
     gcctcgttac tgggaagcac catccacaat tatgggccta cccagcctgg gccctgtgtg      2220
     ccagcactta ctcttttgta aagcacctgt taaaatgaag gacagattta tcaccttgat      2280
     tacggcggtg atgggacctg atcccagcag tcacaagtca caggggaagg tccctgagga      2340
     ccttcaggag ggcggttggt ccaggaccca cacctgcttt cttcatgttt cctgatcccg      2400
     ccctgggtct gcagtcacac atttctggaa acttctctga ggtccaagac ttggaggttc      2460
     ctctaggacc ttaaggccct ggctcctttc tggtatctca caggacattt tcttcccaca      2520
     gatagaaaag gagggagcta ctctcaggct gcaagtaagt atgaaggagg ctgatgcctg      2580
     aggtccttgg gatattgtgt ttgggagccc gtgggggagc tcacccaccc cacaattcct      2640
     cctctagcca catcttctgt gggatctgac caggttctgt ttttgtccta ccccaggcag      2700
     tgacagtgcc cagggctctg atatgtctct cacagcttgt aaaggtgaga gcctggaggg      2760
     cctgatgtgt gttgggtgtt gggcggaaca gtggacgcag ctgtgctatg gggtttcttt      2820
     gcattggatg tattgagcat gcgatgggct gtttaaagtg tgactcctca ctgtgacaga      2880
     tacgaatttg ttcatgaata tttttttcta tagtgtgaga cagctgcctt gtgtgggact      2940
     gagaggcaag atttgttcct gcccttccct ttgtgacttg aagaaccctg actttgtttc      3000
     tgcaaaggca cctgcatgtg tctgtgttct tgtaggcata atgtgaggag gtggggagac      3060
     caccccaccc ccatgtccac catgaccctc ttcccacgct gacctgtgct                 3110
//


spacer
spacer