Dbfetch

ID   AJ554211; SV 1; linear; genomic DNA; STD; HUM; 895 BP.
XX
AC   AJ554211;
XX
DT   31-JUL-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*35 allele,
DE   exons 1-4
XX
KW   HLA-B gene; HLA-B*35 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-895
RA   Czachurski D.;
RT   ;
RL   Submitted (31-MAR-2003) to the INSDC.
RL   Czachurski D., Department of Transplantation Immunology, University of
RL   Heidelberg, Im Neuenheimer Feld 305, D-69120, GERMANY.
XX
RN   [2]
RA   Czachurski D.R., Opelz G., Mytilineos J.;
RT   "A new HLA-B allele found in a German Caucasian individual";
RL   Unpublished.
XX
RN   [3]
RA   Czachurski D.R.;
RT   "HLA-class I Typing by direct sequencing";
RL   Unpublished.
XX
DR   MD5; d706dbec4dbd02920eeb8fbc269b7fe9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..895
FT                   /organism="Homo sapiens"
FT                   /chromosome="6q"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany:Northern Badenia"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..73,74..343,344..619,620..895)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT   CDS             join(<1..73,74..343,344..619,620..>895)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*35:46"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YP32"
FT                   /protein_id="CAD86940.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDATSPRMAPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=1
FT   intron          73..74
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=1
FT   exon            74..343
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=2
FT   intron          343..344
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=2
FT   exon            344..619
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=3
FT   intron          619..620
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=3
FT   exon            620..895
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=4
XX
SQ   Sequence 895 BP; 188 A; 284 C; 295 G; 128 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccacgagtcc gaggatggcg ccccgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacagatc ttcaagacca acacacagac ttaccgagag       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca catcatccag       360
     aggatgtatg gctgcgacct ggggcccgac gggcgcctcc tccgcgggca tgaccagtcc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacacgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggtttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atggg            895
//