Dbfetch

ID   AJ550947; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ550947;
XX
DT   08-APR-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*15 variant
DE   allele, exon 2 and joined CDS
XX
KW   HLA-B gene; HLA-B*15 variant allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Day N.;
RT   ;
RL   Submitted (21-MAR-2003) to the INSDC.
RL   Day N., H and I DNA Reference Laboratory, National Blood Service, Southmead
RL   Road, BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Day S., Bendukidza N., Dunn P., Ward J.;
RT   "Identification of B*15 variant allele";
RL   Unpublished.
XX
DR   MD5; 7656ac2e85e62e6672c8813119d115ad.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ550948.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15 variant"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q860Q0"
FT                   /db_xref="IMGT/HLA:B*15:78:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q860Q0"
FT                   /protein_id="CAD80094.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 88 C; 88 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//