spacer

EBI Dbfetch

ID   AJ550735; SV 1; linear; genomic DNA; STD; HUM; 3269 BP.
XX
AC   AJ550735;
XX
DT   05-MAY-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*4404 allele, exons
DE   1-7
XX
KW   HLA-B gene; HLA-B*4404 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3269
RA   Cox S.T.;
RT   ;
RL   Submitted (05-MAR-2003) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Confirmation of HLA-B*4404";
RL   Unpublished.
XX
DR   MD5; 90a2321edf83cafce1073a9a223aa34a.
DR   Ensembl-Gn; ENSG00000228964; homo_sapiens.
DR   Ensembl-Tr; ENST00000421349; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3269
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="Northern European individual"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(201..273,403..672,916..1191,1767..2042,2136..2252,
FT                   2694..2726,2833..2876)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4404"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P30481"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*44:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1M6O"
FT                   /db_xref="PDB:1N2R"
FT                   /db_xref="PDB:1SYS"
FT                   /db_xref="PDB:1SYV"
FT                   /db_xref="PDB:3DX6"
FT                   /db_xref="PDB:3DX7"
FT                   /db_xref="PDB:3DX8"
FT                   /db_xref="PDB:3DXA"
FT                   /db_xref="PDB:3KPL"
FT                   /db_xref="PDB:3KPM"
FT                   /db_xref="PDB:3KPN"
FT                   /db_xref="PDB:3KPO"
FT                   /db_xref="PDB:3KPP"
FT                   /db_xref="PDB:3KPQ"
FT                   /db_xref="PDB:3KPR"
FT                   /db_xref="PDB:3KPS"
FT                   /db_xref="PDB:3L3D"
FT                   /db_xref="PDB:3L3G"
FT                   /db_xref="PDB:3L3I"
FT                   /db_xref="PDB:3L3J"
FT                   /db_xref="PDB:3L3K"
FT                   /db_xref="PDB:4JQX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30481"
FT                   /protein_id="CAD79566.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQRRAYLEGTCVESLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   VTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            <201..273
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4404"
FT                   /number=1
FT   intron          274..402
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4404"
FT                   /number=1
FT   exon            403..672
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4404"
FT                   /number=2
FT   intron          673..915
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4404"
FT                   /number=2
FT   exon            916..1191
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4404"
FT                   /number=3
FT   intron          1192..1766
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4404"
FT                   /number=3
FT   exon            1767..2042
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4404"
FT                   /number=4
FT   intron          2043..2135
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4404"
FT                   /number=4
FT   exon            2136..2252
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4404"
FT                   /number=5
FT   intron          2253..2693
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4404"
FT                   /number=5
FT   exon            2694..2726
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4404"
FT                   /number=6
FT   intron          2727..2832
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4404"
FT                   /number=6
FT   exon            2833..2876
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4404"
FT                   /number=7
XX
SQ   Sequence 3269 BP; 604 A; 952 C; 1025 G; 688 T; 0 other;
     ttggggattc cccactccca cgagtttcac ttcttctccc aacctatgtc gggtccttct        60
     tccaggatac tcgtgacgcg tccccatttc ccactcccat tgggtgtcgg gtgtctagag       120
     aagccaatca gtgtcgccgg ggtcccagtt ctaaagtccc cacgcaccca cccggactca       180
     gaatctcctc agacgccgag atgcgggtca cggcgccccg aaccctcctc ctgctgctct       240
     ggggggcagt ggccctgacc gagacctggg ccggtgagtg cggggtcggg agggaaatgg       300
     cctctgtggg gaggagagag gggaccgcag gcgggggcgc aggacccggg gagccgcgcc       360
     gggaggaggg tcgggcgggt ctcagcccct cctcgccccc aggctcccac tccatgaggt       420
     atttctacac cgccatgtcc cggcccggcc gcggggagcc ccgcttcatc accgtgggct       480
     acgtggacga cacgctgttc gtgaggttcg acagcgacgc cacgagtccg aggaaggagc       540
     cgcgggcgcc atggatagag caggaggggc cggagtattg ggaccgggag acacagatct       600
     ccaagaccaa cacacagact taccgagaga acctgcgcac cgcgctccgc tactacaacc       660
     agagcgaggc cggtgagtga ccccggcccg gggcgcaggt cacgactccc catcccccac       720
     gtacggcccg ggtcgccccg agtctccggg tccgagatcc gcccccgagg ccgcgggacc       780
     cgcccagacc ctcgaccggc gagagcccca ggcgcgttta cccggtttca ttttcagttg       840
     aggccaaaat ccccgcgggt tggtcggggc ggggcggggc tcgggggacg gggctgaccg       900
     cggggccggg gccagggtct cacatcatcc agaggatgta cggctgcgac gtggggccgg       960
     acgggcgcct cctccgcggg tatgaccagg acgcctacga cggcaaggat tacatcgccc      1020
     tgaacgagga cctgagctcc tggaccgcgg cggacaccgc ggctcagatc acccagcgca      1080
     agtgggaggc ggcccgtgtg gcggagcagc ggagagccta cctggagggc acgtgcgtgg      1140
     agtcgctccg cagatacctg gagaacggga aggagacgct gcagcgcgcg ggtaccaggg      1200
     gcagtgggga gccttcccca tctcctatag gtcgccgggg atggcctccc acgagaagag      1260
     gaggaaaatg ggatcagcgc tagaatgtcg ccctcccttg aatggagaat ggcatgagtt      1320
     ttcctgagtt tcctctgagg gccccctctt ctctctagga caattaaggg atgacgtctc      1380
     tgaggaaatg gaggggaaga cagtccctag aatactgatc aggggtcccc tttgacccct      1440
     gcagcagcct tgggaaccgt gacttttcct ctcaggcctt gttctctgcc tcacactcag      1500
     tgtgtttggg gctctgattc cagcacttct gagtcacttt acctccactc agatcaggag      1560
     cagaagtccc tgttccccgc tcagagactc gaactttcca atgaatagga gattatccca      1620
     ggtgcctgcg tccaggctgg tgtctgggtt ctgtgcccct tccccacccc aggtgtcctg      1680
     tccattctca ggctggtcac atgggtggtc ctagggtgtc ccatgagaga tgcaaagcgc      1740
     ctgaattttc tgactcttcc catcagaccc cccaaagaca catgtgaccc accaccccat      1800
     ctctgaccat gaggtcaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac      1860
     actgacctgg cagcgggatg gcgaggacca aactcaggac accgagcttg tggagaccag      1920
     accagcagga gatagaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga      1980
     gcagagatac acatgccatg tacagcatga ggggctgccg aagcccctca ccctgagatg      2040
     gggtaaggag ggggatgagg ggtcatatct cttctcaggg aaagcaggag cccttcagca      2100
     gggtcagggc ccctcatctt cccttccttt cccagagccg tcttcccagt ccaccgtccc      2160
     catcgtgggc attgttgctg gcctggctgt cctagcagtt gtggtcatcg gagctgtggt      2220
     cgctgctgtg atgtgtagga ggaagagctc aggtagggaa ggggtgaggg gtggggtctg      2280
     ggttttcttg tcccactggg ggtttcaagc cccaggtaga agtgttccct gcctcattac      2340
     tgggaagcag catccacaca ggggctaacg cagcctggga ccctgtgtgc cagcacttac      2400
     tcttttgtgc agcacatgtg acaatgaagg acggatgtat caccttggtg gttgtggtgt      2460
     tggggtcctg attccagcat tcatgagtca ggggaaggtc cctgctaagg acagacctta      2520
     ggagggcagt tggtccagga cccacacttg ctttcctcgt gtttcctgat cctgccttgg      2580
     gtctgtagtc atacttctgg aaattccttt tgggtccaag acgaggaggt tcctctaaga      2640
     tctcatggcc ctgcttcctc ccagtcccct cacagggcat tttcttccca caggtggaaa      2700
     aggagggagc tactctcagg ctgcgtgtaa gtgatggggg cgggagtgtg gaggagctca      2760
     cccaccccat aattcctcct gtcccacgtc tcctgcgggc tctgaccagg tcctgttttt      2820
     gttctactcc aggcagcgac agtgcccagg gctctgatgt gtctctcaca gcttgaaaag      2880
     gtgagattct tggggtctag agtgggtggg gtggcaggtc tgggggtggg tggggcagtg      2940
     gggaaaggcc tgggtaatgg agattctttg attgggatgt ttcgcgtgtg tggtgggctg      3000
     tttagagtgt catcacttac catgactaac cagaatttgt tcatgactgt tgttttctgt      3060
     agcctgagac agctgtcttg tgagggactg agatgcagga tttcttcacg cctccccttt      3120
     gtgacttcaa gagcctctgg catctctttc tgcaaaggca cctgaatgtg tctgcgtccc      3180
     tgttagcata atgtgaggag gtggagagac agcccacccc cgtgtccacc gtgacccctg      3240
     ttcgcatgct gacctgtgtt tcctcccca                                        3269
//


spacer
spacer