spacer

EBI Dbfetch

ID   AJ550636; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ550636;
XX
DT   11-JUN-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, novel HLA-B*07 allele,
DE   exon 2 and joined CDS
XX
KW   HLA-B gene; human leucocyte antigen B; major histocompatability complex;
KW   MHC class I antigen; novel HLA-B*07 allele.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Poli F.;
RT   ;
RL   Submitted (19-MAR-2003) to the INSDC.
RL   Poli F., C.T.I.T, Ospedale Maggiore Policlinico di Milano, Via Francesco
RL   Sforza, 35 - Milano, 20122, ITALY.
XX
RN   [2]
RA   Poli F.;
RT   "Identification of a new HLA-B*07";
RL   Unpublished.
XX
DR   MD5; 201cf282e3a43c031099f050c3f53a05.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p21"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ550637.1:1..276,AJ550638.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="novel HLA-B*07"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q7YQ36"
FT                   /db_xref="IMGT/HLA:B*07:32"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YQ36"
FT                   /protein_id="CAD79474.2"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGEC
FT                   VEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="novel HLA-B*07"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 86 C; 88 G; 37 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer