spacer

EBI Dbfetch

ID   AJ549199; SV 1; linear; genomic DNA; STD; HUM; 3269 BP.
XX
AC   AJ549199;
XX
DT   04-MAY-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*07xx allele, exons
DE   1-7
XX
KW   HLA-B gene; HLA-B*07xx allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3269
RA   Cox S.T.;
RT   ;
RL   Submitted (04-MAR-2003) to the INSDC.
RL   Cox S.T., Dept. of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Sequence of X new HLA class I alleles";
RL   Unpublished.
XX
DR   MD5; a72971a1f0d0ddd2d034f643bade0282.
DR   EPD; EP73522; HS_HLA-B.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3269
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(201..273,402..671,917..1192,1767..2042,2136..2252,
FT                   2694..2726,2833..2876)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07xx"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q860I7"
FT                   /db_xref="IMGT/HLA:B*07:33:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q860I7"
FT                   /protein_id="CAD79562.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            <201..273
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07xx"
FT                   /number=1
FT   intron          274..401
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07xx"
FT                   /number=1
FT   exon            402..671
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07xx"
FT                   /number=2
FT   intron          672..916
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07xx"
FT                   /number=2
FT   exon            917..1192
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07xx"
FT                   /number=3
FT   intron          1193..1766
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07xx"
FT                   /number=3
FT   exon            1767..2042
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07xx"
FT                   /number=4
FT   intron          2043..2135
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07xx"
FT                   /number=4
FT   exon            2136..2252
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07xx"
FT                   /number=5
FT   intron          2253..2693
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07xx"
FT                   /number=5
FT   exon            2694..2726
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07xx"
FT                   /number=6
FT   intron          2727..2832
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07xx"
FT                   /number=6
FT   exon            2833..2876
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07xx"
FT                   /number=7
XX
SQ   Sequence 3269 BP; 600 A; 949 C; 1023 G; 697 T; 0 other;
     ttggggattc cccacttccc tgagtttcac ttcttctccc aacttgtgtc gggtccttct        60
     tccgggatac tcgtgacgcg tccccacttc ccactcccat tgggtattgg atatctagag       120
     aagccaatca gcgtcgccgc ggtcccagtt ctaaagtccc cacgcaccca cccggactca       180
     gagtctcctc agacgccgag atgctggtca tggcgccccg aaccgtcctc ctgctgctct       240
     cggcggccct ggccctgacc gagacctggg ccggtgagtg cgggtcggga gggaaatggc       300
     ctctgccggg aggagcgagg ggaccgcagg cgggggcgca ggacctgagg agccgcgccg       360
     ggaggagggt cgggcgggtc tcagcccctc ctcaccccca ggctcccact ccatgaggta       420
     tttctacacc tccgtgtccc ggcccggccg cggggagccc cgcttcatct cagtgggcta       480
     cgtggacgac acccagttcg tgaggttcga cagcgacgcc gcgagtccga gagaggagcc       540
     gcgggcgccg tggatagagc aggaggggcc ggagtattgg gaccggaaca cacagatcta       600
     caaggcccag gcacagactg accgagagag cctgcggaac ctgcgcggct actacaacca       660
     gagcgaggcc ggtgagtgac cccggcccgg ggcgcaggtc acgactcccc atcccccacg       720
     tacggcccgg gtcgccccga gtctccgggt ccgagatccg cctccctgag gccgcgggac       780
     ccgcccagac cctcgaccgg cgagagcccc aggcgcgttt acccggtttc attttcagtt       840
     gaggccaaaa tccccgcggg ttggtcgggg cggggcgggg ctcgggggac tgggctgacc       900
     gcggggccgg ggccagggtc tcacaccctc cagagcatgt acggctgcga cgtggggccg       960
     gacgggcgcc tcctccgcgg gcatgaccag tacgcctacg acggcaagga ttacatcgcc      1020
     ctgaacgagg acctgcgctc ctggaccgcc gcggacacgg cggctcagat cacccagcgc      1080
     aagtgggagg cggcccgtga ggcggagcag cggagagcct acctggaggg cgagtgcgtg      1140
     gagtggctcc gcagatacct ggagaacggg aaggagacgc tgcagcgcgc gggtaccagg      1200
     ggcagtgggg agccttcccc atctcctata ggtcgccggg gatggcctcc cacgagaaga      1260
     ggaggaaaat gggatcagcg ctagaatgtc gccctccgtt gaatggagaa tggcatgagt      1320
     tttcctgagt ttcctctgag ggccccctct tctctctaga caattaagga atgacgtctc      1380
     tgaggaaatg gaggggaaga cagtccctag aatactgatc aggggtcccc tttgacccct      1440
     gcagcagcct tgggaaccgt gacttttcct ctcaggcctt gttctctgcc tcacactcag      1500
     tgtgtttggg gctctgattc cagcacttct gagtcacttt acctccactc agatcaggag      1560
     cagaagtccc tgttccccgc tcagagactc gaactttcca atgaatagga gattatccca      1620
     ggtgcctgcg tccaggctgg tgtctgggtt ctgtgcccct tccccacccc aggtgtcctg      1680
     tccattctca ggctggtcac atgggtggtc ctagggtgtc ccatgaaaga tgcaaagcgc      1740
     ctgaattttc tgactcttcc catcagaccc cccaaagaca cacgtgaccc accaccccat      1800
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggt ttctaccctg cggagatcac      1860
     actgacctgg cagcgggatg gcgaggacca aactcaggac actgagcttg tggagaccag      1920
     accagcagga gatagaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga      1980
     gcagagatac acatgccatg tacagcatga ggggctgccg aagcccctca ccctgagatg      2040
     gggtaaggag ggggatgagg ggtcatatct cttctcaggg aaagcaggag cccttcagca      2100
     gggtcagggc ccctcatctt cccctccttt cccagagccg tcttcccagt ccaccgtccc      2160
     catcgtgggc attgttgctg gcctggctgt cctagcagtt gtggtcatcg gagctgtggt      2220
     cgctgctgtg atgtgtagga ggaagagttc aggtagggaa ggggtgaggg gtggggtctg      2280
     ggttttcttg tcccactggg ggtttcaagc cccaggtaga agtgttccct gcctcattac      2340
     tgggaagcag catgcacaca ggggctaacg cagcctggga ccctgtgtgc cagcacttac      2400
     tcttttgtgc agcacatgtg acaatgaagg atggatgtat caccttgatg gttgtggtgt      2460
     tggggtcctg attccagcat tcatgagtca ggggaaggtc cctgctaagg acagacctta      2520
     ggagggcagt tggtccagga cccacacttg ctttcctcgt gtttcctgat cctgccctgg      2580
     gtctgtagtc atacttctgg aaattccttt tgggtccaag actaggaggt tcctctaaga      2640
     tctcatggcc ctgcttcctc ccagtgccct cacaggacat tttcttccca caggtggaaa      2700
     aggagggagc tactctcagg ctgcgtgtaa gtggtggggg tgggagtgtg gaggagctca      2760
     cccaccccat aattcctcct gtcccacgtc tcctgcgggc tctgaccagg tcctgttttt      2820
     gttctactcc aggcagcgac agtgcccagg gctctgatgt gtctctcaca gcttgaaaag      2880
     gtgagattct tggggtctag agtgggtggg gtggcgggtc tgggggtggg tggggcagag      2940
     gggaaaggcc tgggtaatgg ggattctttg attgggatgt ttcgcgtgtg tggtgggctg      3000
     tttagagtgt catcgcttac catgactaac cagaatttgt tcatgactgt tgttttctgt      3060
     agcctgagac agctgtcttg tgagggactg agatgcagga tttcttcacg cctccccttt      3120
     gtgacttcaa gagcctctgg catctctttc tgcaaaggca cctgaatgtg tctgcgtccc      3180
     tgttagcata atgtgaggag gtggagagac agcccaccct tgtgtccact gtgacccctg      3240
     ttcgcatgct gacctgtgtt tcctcccca                                        3269
//


spacer
spacer