spacer

EBI Dbfetch

ID   AJ548757; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ548757;
XX
DT   28-FEB-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*270503
DE   allele, exon 2 and joined CDS
XX
KW   HLA-B gene; HLA-B*270503 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Perasaari J.P.;
RT   ;
RL   Submitted (28-FEB-2003) to the INSDC.
RL   Perasaari J.P., Department of Tissue Typing, Finnish Red Cross Blood
RL   Transfusion Serv, Kivihaantie 7, FIN-00310 Helsinki, FINLAND.
XX
RN   [2]
RA   Perasaari J.P., Koskela S., Partanen J.;
RT   "Confirmatory sequence of B*270503";
RL   Unpublished.
XX
DR   MD5; a0a775bda7447919a74747d22c83ed48.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Finland"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,AJ548758.1:1..>276)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*270503"
FT   CDS             join(<1..270,AJ548758.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*270503"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q861A2"
FT                   /db_xref="IMGT/HLA:B*27:05:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q861A2"
FT                   /protein_id="CAD68985.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGP
FT                   DGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*270503"
FT                   /number=2
XX
SQ   Sequence 270 BP; 54 A; 87 C; 93 G; 36 T; 0 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctgc aaggccaagg cacagactga ccgagaggac ctgcggaccc       240
     tgctccgcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer