spacer

EBI Dbfetch

ID   AJ547623; SV 1; linear; genomic DNA; STD; INV; 4083 BP.
XX
AC   AJ547623;
XX
DT   31-MAR-2004 (Rel. 79, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Bactrocera oleae tra-2 gene for transformer-2 protein, exons 1-8
XX
KW   tra-2 gene; transformer-2 protein.
XX
OS   Bactrocera oleae (olive fruit fly)
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Tephritoidea;
OC   Tephritidae; Bactrocera; Daculus.
XX
RN   [1]
RP   1-4083
RA   Komitopoulou K.S.;
RT   ;
RL   Submitted (22-FEB-2003) to the INSDC.
RL   Komitopoulou K.S., Department of Genetics and Biotechnology, University of
RL   Athens, Panepistimiopolis, Kouponia, Athens 157 01, GREECE.
XX
RN   [2]
RA   Lagos D.I., Komitopoulou K.S.;
RT   "Organization and expression of the tra-2 gene in the olive fruit fly
RT   Bactrocera oleae";
RL   Unpublished.
XX
DR   MD5; 19e560c195f245a3cd5e6f36033241d7.
DR   EuropePMC; PMC2427042; 18500975.
DR   EuropePMC; PMC2710159; 19433631.
DR   EuropePMC; PMC2885393; 20465812.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4083
FT                   /organism="Bactrocera oleae"
FT                   /mol_type="genomic DNA"
FT                   /country="Greece"
FT                   /dev_stage="embryo"
FT                   /clone="lamda DASH II tra-2"
FT                   /db_xref="taxon:104688"
FT   CAAT_signal     173..176
FT                   /gene="tra-2"
FT   TATA_signal     188..192
FT                   /gene="tra-2"
FT   mRNA            join(306..408,705..784,844..969,1815..1893,1961..2089,
FT                   2345..2520,2602..2747,2808..3653)
FT                   /gene="tra-2"
FT   5'UTR           306..406
FT                   /gene="tra-2"
FT   exon            306..408
FT                   /gene="tra-2"
FT                   /number=1
FT   CDS             join(406..408,705..784,844..969,1815..1893,1961..2089,
FT                   2345..2520,2602..2747,2808..2824)
FT                   /gene="tra-2"
FT                   /product="transformer-2 protein"
FT                   /function="splicing factor and RNA binding protein"
FT                   /db_xref="GOA:Q70TB2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:Q70TB2"
FT                   /protein_id="CAD67988.1"
FT                   /translation="MSPRSRSRSLSPRRSYTKSPVRRGNGRRRHSREKFYSSRSRSASR
FT                   QPPSPPPLPSGRGGRYSEASQSSSTSLSPRHGRRITRSRSRSTHENRRGNREKPVQNRC
FT                   IGVFGLSVYTTQQKIRDIFSRFGPIERIQVVIDAQTGRSRGFCFIYYEDIADAKAAKDA
FT                   CSGMEIDDRRIRVDYSTTQRPHTPTPGVYMGRQTRREREHNDRYRDDYRPRRRSGSPYH
FT                   NRSNNYRSDRSRRYERSRSRSYSPRRARY"
FT   intron          409..704
FT                   /gene="tra-2"
FT                   /number=1
FT   exon            705..784
FT                   /gene="tra-2"
FT                   /number=2
FT   intron          785..843
FT                   /gene="tra-2"
FT                   /number=2
FT   exon            844..969
FT                   /gene="tra-2"
FT                   /number=3
FT   intron          970..1814
FT                   /gene="tra-2"
FT                   /number=3
FT   exon            1815..1893
FT                   /gene="tra-2"
FT                   /number=4
FT   intron          1894..1960
FT                   /gene="tra-2"
FT                   /number=4
FT   exon            1961..2089
FT                   /gene="tra-2"
FT                   /number=5
FT   intron          2090..2344
FT                   /gene="tra-2"
FT                   /number=5
FT   exon            2345..2520
FT                   /gene="tra-2"
FT                   /number=6
FT   intron          2521..2601
FT                   /gene="tra-2"
FT                   /number=6
FT   exon            2602..2747
FT                   /gene="tra-2"
FT                   /number=7
FT   intron          2748..2807
FT                   /gene="tra-2"
FT                   /number=7
FT   exon            2808..3653
FT                   /gene="tra-2"
FT                   /number=8
FT   3'UTR           2824..3653
FT                   /gene="tra-2"
XX
SQ   Sequence 4083 BP; 1386 A; 683 C; 654 G; 1359 T; 1 other;
     atttgtattt gctaaaaagt ttatataaaa tagaaaaaaa ctattgctgt aaattaaaat        60
     atttgtgtaa taaaatgcag tttttaaata aactaagtaa tgtttgaaat aagttatatt       120
     aaatgttggt taattgcaaa aatatgtata ccatattttg ttgatgcaat agcaattgat       180
     gtatcgctat aaatatttgg agagttggca actttcacca tattaccatt gtgaatgttg       240
     ctacttcaga aagtttattg tgaattatca actcatagtc acagcaagcg ggcatttaca       300
     ttttaatcac aagctatttg tgaaaattcg tgatagaata ttagttatag tgtgctgcta       360
     gcagttattt aaaaaataaa aaataaaccc cgtagaatag ttgtaatggt aagtctatat       420
     atataaaata ttagtttttt aaaacaacgt tacggatgct agaggcagtt tgcgctagaa       480
     tactctgcat tgttaaccgg tgtgtacata tctagttata tagaagtgaa tagttaataa       540
     attcgcaaaa actttgaaaa taattcgcat agattgtaaa gatagtatcg agctgagttg       600
     atattaaatt aaaccaaacg ttaacataac ctcattatgt cggtttatgt ttagggtatt       660
     tgcgaaatat caaatagcaa tattgaattt ttttcttatt gtagagccca cgttcacgta       720
     gccgtagcct ttccccacgt cgcagttaca ctaagtcgcc agttcgtcgc ggcaatgggc       780
     gccggtaggt atcaattgct tatccaattt gctataaata gtaatattaa ctttcttata       840
     taggcggcat tctagagaaa agttttatag ctctcgcagt agatcagctt cacgacaacc       900
     gccttctcca ccaccactgc catcaggacg aggtggacgt tactcagaag ccagccaaag       960
     ctcttcaacg taagtatcta ccatacacaa ttcatgctag ttgctaattt atgcatcaat      1020
     atatttacat ttattttttc atgttttatg agtagccatg acaaccagaa tttatttttt      1080
     tttgtttctg ccaagttttt agtttcacca agtggataaa ttttcttgca aggcgtcaat      1140
     aatcatttaa aaatcatgaa acatgtgtgt tttgtttttt gtcggagctt gagttactag      1200
     actaactaga tttatatata tttttttctt caatgtagct atataaaaat ttttcacggc      1260
     tgtaaataac taaagccttt cgacatggtg tgagttttgt catttttcgg aatctcgaat      1320
     tatttttaag cactgtattt acaacgaaag ttttcaataa cgtagtggtt gttttttccg      1380
     tttcagaata gtgaaattat agcaaaaact tatatgaact caaataatga aaggcataat      1440
     ttcaatgtaa gattcgattt caaaaatata cacagaattg acttgaacgg caacaattct      1500
     caaacaaaaa ccaaatgtta cttctgtgaa ttaaaagatc gagataatcg gcgaaacgca      1560
     aaaaaaaagt acacaatatt atcaagtcta atgcaacagc gcaagttttg caaattacat      1620
     cacaatataa tcctttcaat gaaactcaag tgtgaaatgc attaaaaaaa tgaattttta      1680
     acgggcacac atgaaaagct aatgatcaac acagttatca gcgcgaatag ttttttgaaa      1740
     atatatattt acacttggtg tggtatatcc aacattcaat atttgcattt tttccatctt      1800
     tcgcatgtta aaaggtcact ctcaccacgt catggccgtc gtataacccg ttcacgttct      1860
     cgcagcacac acgaaaatcg tcgcggtaat cgagtaagtc ctattgactt gattttaaat      1920
     gtttatgcat ttgtaatatt tttggttcac attttgacag gaaaaaccag tgcaaaatcg      1980
     ttgtataggt gtatttggtt taagtgtgta tacaacgcaa caaaaaatac gtgatatatt      2040
     ttcaagattt ggacccatcg aacgaataca agtcgtaatt gatgcacagg tgagcagatt      2100
     gattatacaa gagattacgg tgaagttgcc atacaaatat tacgcataca tttacaaaaa      2160
     atactttttg ctaaatgatg taaaaaatgg ctaaactaat tacttgctaa attggtgata      2220
     atgagtagtg cgctaaagac gcttgcgtgc atatgctaaa ggctctccca tacacttaaa      2280
     aacactgagc attaaaaatt tttgtttttt tgtctatgta aataatataa tttatacttc      2340
     gcagactgga agatcgcgcg gattttgttt tatttattat gaagacatag cggatgctaa      2400
     ggcggccaag gacgcttgct ccggcatgga aatcgatgat cggcgcataa gagttgatta      2460
     ctcaacaaca caaagaccgc acacacccac acctggtgtc tatatgggcc gacaaacacg      2520
     gtatgttaac aaatagtaat atacatacat acatatgtat agtaaatcgt taataatttt      2580
     tctctacctt catttgccaa ggcgtgaacg tgaacataat gatcgctata gagatgacta      2640
     tcggccgcgc cgtcgctcgg gctcacctta tcacaatcgc agcaataatt accgcagtga      2700
     tcgaagccgt cgttatgaac gcagccgaag tcgttcctat tcgccgcgta tgtatattca      2760
     ctacaaaatc ttgtataatc tattgaatgt ttgttttatg tttacagggc gcgcacgcta      2820
     ctaaaatcgc tccatgcata taaattaaac tgttatcagt aatttatacg caaaagaaaa      2880
     aagacacaca cacacacctc agtgctatag tagtggtgtc gaaaaataaa ctgttaccta      2940
     tatttttcaa atggatttaa tgtgcaaaaa gcgaacaaaa aaattacaaa attacaaaca      3000
     gctactgaat tttaccgtaa tatcatgagt tattgtttgg ttgcattagt gtttcgttaa      3060
     ggttgccata ctatattcag catttggcag caaattcttt attataaata atgtttcgaa      3120
     taatttgtat tttcaaaaat tcaatactgg catcaacgac gtgttcagca agcagcacaa      3180
     tatttcacac tttcgcccca cttcggaatt tactcagttt ttttttattg tttatgctag      3240
     tttcaatgca attacaattg ctacttattt aataatacca ttattatttg cttacttata      3300
     attgttatta acaacacatt ttattagttg actaccaaac atttcaatca gtcactttaa      3360
     tgtttagcag tagagtgtag cgtatcgcaa tttcccaatt ataaaatata aacaaaaaca      3420
     ccagttaaat gtgctgtagc aacctctgca ttgaagaatt agcatatgta actatttaca      3480
     tgtatgtatg tatgtccact agacattatc gaataactgt ggggtagacg tttcgctact      3540
     atttttatat attataaaaa aaagcgagac tacaactttt gtttacttgt aattttaatt      3600
     agttttaata tttactaata aaaatggaat aaaagatgaa gaaaaaatct aaagcaaatg      3660
     attttcaatt tatacatgta tgcatgaatt atatacggga aaaacagctc tagaaaaatt      3720
     aattgaaaat attttgaaat gtaaaactct tagagcctta gcggcgtttt ctagttcctt      3780
     aaagcaatta aatatcaaat ttgcttcaat tataacttct atctgcaact aatagttgtt      3840
     ttcacagctt tacatatata tttttgaaaa taaaaaacgc agttacttgt tggcattatg      3900
     ttgttgtgtt tgcctggagg tcttatacgc tatctccagt gtactttgta taatttgcat      3960
     gtcactttct atstacgcgc ccaattctcc acatcgccca gctcctacaa caaaaaaata      4020
     aaataaataa aaaattgccc atatagcccc attacagcat atgtaccttc aatgcactac      4080
     tga                                                                    4083
//


spacer
spacer