spacer

EBI Dbfetch

ID   AJ544284; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ544284;
XX
DT   13-AUG-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for MHC class 1 antigen, HLA-A*022001
DE   allele, exon 2, isolate 23675
XX
KW   HLA-A gene; HLA-A*022001 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Gervais T.G.;
RT   ;
RL   Submitted (13-FEB-2003) to the INSDC.
RL   Gervais T.G., Immunohaematology, UCL Cliniques St Luc, Clos
RL   Chapelle-aux-Champs, 30 POBox 3052, Brussels, 1200, BELGIUM.
XX
RN   [2]
RA   Gervais T.G., Latinne D.;
RT   "Confirmatory sequence of exons 2 and 3 and sequence of exon 4 for the
RT   HLA-A*022001 gene obtained by sequence based typing";
RL   Unpublished.
XX
DR   MD5; c78655a40adebd6dec95559a6a1f8a60.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="23675"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*022001"
FT                   /product="MHC class 1 antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q7YNX9"
FT                   /db_xref="IMGT/HLA:A*02:20:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YNX9"
FT                   /protein_id="CAD66673.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRNVKAHSQTHRVDLGTLRGYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*022001"
FT                   /number=2
XX
SQ   Sequence 270 BP; 52 A; 82 C; 96 G; 40 T; 0 other;
     gctctcactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg       180
     acggggagac acggaatgtg aaggcccact cacagactca ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer