Dbfetch

ID   AJ539145; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ539145;
XX
DT   24-APR-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*44 allele,
DE   exon 2 and joined CDS
XX
KW   HLA-B gene; HLA-B*44 allele; human leucocyte antigen B;
KW   major histocompatability complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Anholts J.D.H.;
RT   ;
RL   Submitted (23-JAN-2003) to the INSDC.
RL   Anholts J.D.H., Immunohematology and Bloodtransfusion, Leids Universitair
RL   Medisch Centrum, Albinusdreef 2, 2333 ZA Leiden, NETHERLANDS.
XX
RN   [2]
RA   Anholts J.D.H., Schreuder I.G.M.T.;
RT   "Six new HLA Class I alleles found and conformation of DRB1*0322, DRB1*1433
RT   and A*3106";
RL   Unpublished.
XX
DR   MD5; ecdba2d48dfc509e9aa2dd4b68dd9e7d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..270,AJ539146.1:1..276)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44"
FT   CDS             join(<1..270,AJ539146.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*44:35"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q860P7"
FT                   /protein_id="CAD62185.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQERAYLEGLC
FT                   VESLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44"
FT                   /number=2
XX
SQ   Sequence 270 BP; 60 A; 89 C; 85 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//