spacer

EBI Dbfetch

ID   AJ538195; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ538195;
XX
DT   24-JAN-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*68 allele,
DE   exon 3
XX
KW   HLA-A gene; HLA-A*68 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Day S.;
RT   ;
RL   Submitted (23-JAN-2003) to the INSDC.
RL   Day S., H and I DNA Reference Laboratory, National Blood Service, Southmead
RL   Rd, BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2005.00399.x.
RX   PUBMED; 15853904.
RA   Davey S., Carter V., Goodman R., Day S., Brown C., Morris J., Key T.,
RA   Bendukidze N., Dunn P.P.J.;
RT   "A new HLA-A allele, HLA-A*6824, identified in three unrelated
RT   individuals";
RL   Tissue Antigens 65(5):485-487(2005).
XX
DR   MD5; 039596be10b1d76950a8d9229c1167e9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*068"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecue"
FT                   /db_xref="GOA:Q861A6"
FT                   /db_xref="IMGT/HLA:A*68:24"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q861A6"
FT                   /protein_id="CAD61341.1"
FT                   /translation="SHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAA
FT                   DMAAQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRT"
XX
SQ   Sequence 276 BP; 58 A; 78 C; 101 G; 39 T; 0 other;
     gttctcacac catccagatg atgtatggct gcgacgtggg gtcggacggg cgcttcctcc        60
     gcgggtaccg gcaggacgcc tacgacggca aggattacat cgccctgaaa gaggacctgc       120
     gctcttggac cgcggcggac atggcagctc agaccaccaa gcacaagtgg gaggcggccc       180
     atgtggcgga gcagtggaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcacgg                                 276
//


spacer
spacer