spacer

EBI Dbfetch

ID   AJ538194; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ538194;
XX
DT   24-JAN-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*68 allele,
DE   exon 2
XX
KW   HLA-A gene; HLA-A*68 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Day S.;
RT   ;
RL   Submitted (23-JAN-2003) to the INSDC.
RL   Day S., H and I DNA Reference Laboratory, National Blood Service, Southmead
RL   Rd, BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2005.00399.x.
RX   PUBMED; 15853904.
RA   Davey S., Carter V., Goodman R., Day S., Brown C., Morris J., Key T.,
RA   Bendukidze N., Dunn P.P.J.;
RT   "A new HLA-A allele, HLA-A*6824, identified in three unrelated
RT   individuals";
RL   Tissue Antigens 65(5):485-487(2005).
XX
DR   MD5; 9784a3f2712d7122845510ba99d29d35.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecue"
FT                   /db_xref="GOA:Q861A7"
FT                   /db_xref="IMGT/HLA:A*68:24"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q861A7"
FT                   /protein_id="CAD61340.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVRAQSQTDRVDLGTLRGYYNQSEA"
XX
SQ   Sequence 270 BP; 51 A; 84 C; 97 G; 38 T; 0 other;
     gctcccactc catgaggtat ttctacactt ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg agggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer