Dbfetch

ID   AJ538193; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ538193;
XX
DT   24-JAN-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*02 allele,
DE   exon 3
XX
KW   HLA-A gene; HLA-A*02 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Day S.;
RT   ;
RL   Submitted (23-JAN-2003) to the INSDC.
RL   Day S., H and I DNA Reference Laboratory, National Blood Service, Southmead
RL   Rd, BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Day S., Jobson S.;
RT   "Identification of a new HLA-A*02 allele";
RL   Unpublished.
XX
DR   MD5; 9b7baa442653a52305c3dab6cafafca1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:A*02:62"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q861A8"
FT                   /protein_id="CAD61339.1"
FT                   /translation="SHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAA
FT                   DMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRT"
XX
SQ   Sequence 276 BP; 58 A; 79 C; 98 G; 41 T; 0 other;
     gttctcacac cgtccagagg atgtatggct gcgacgtggg gtcggactgg cgcttcctcc        60
     gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa gaggacctgc       120
     gctcttggac cgcggcggac atggcagctc agaccaccaa gcacaagtgg gaggcggccc       180
     atgtggcgga gcagttgaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcacgg                                 276
//