spacer

EBI Dbfetch

ID   AJ537578; SV 1; linear; mRNA; STD; HUM; 545 BP.
XX
AC   AJ537578;
XX
DT   22-JAN-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial mRNA for MHC class I antigen (HLA-C gene), HLA-Cw*16
DE   allele
XX
KW   HLA-C gene; HLA-Cw*16 allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-545
RA   Mas V.;
RT   ;
RL   Submitted (21-JAN-2003) to the INSDC.
RL   Mas V., Servei d'Immunologia, Hospital Clinic, Villarroel 170, 08036,
RL   SPAIN.
XX
RN   [2]
RA   Mas V., Gimferrer I., Vives J., Lozano F.;
RT   "A new HLA-Cw*16 allele carrying two relevant amino acid substitutions in
RT   the alpha 2 domain";
RL   Unpublished.
XX
DR   MD5; 5fe924e247e084231a281b6b45c7ce35.
XX
CC   Related entry AJ420251
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..545
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /country="Spain"
FT                   /sex="male"
FT                   /cell_type="leukocytes"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>545
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*16"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q861B1"
FT                   /db_xref="H-InvDB:HIT000248569.9"
FT                   /db_xref="IMGT/HLA:C*16:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q861B1"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAD61205.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMSGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   variation       288
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*1601"
FT                   /replace="t"
FT   variation       295
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*1601"
FT                   /replace="a"
XX
SQ   Sequence 545 BP; 105 A; 174 C; 198 G; 68 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtctggct       300
     gcgacctggg gcccgacggg cgcctcctcc gcgggtatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggac acggcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgcggcgga gcagcagaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcg                                                                   545
//


spacer
spacer