Dbfetch

ID   AJ537477; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ537477;
XX
DT   21-JAN-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*2429 allele,
DE   exon 2 and joined CDS
XX
KW   HLA-A gene; HLA-A*2429, allele; human leucocyte antigen A;
KW   major histocompatability complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Dunn P.P.;
RT   ;
RL   Submitted (21-JAN-2003) to the INSDC.
RL   Dunn P.P., H & I DNA Reference Laboratory, National Blood Service,
RL   Southmead Road, BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Dunn P.;
RT   "Confirmation of the sequence of HLA-A*2429 allele found in a potential
RT   bone marrow donor";
RL   Unpublished.
XX
DR   MD5; 5195cdc3f15fc9904b1bcee22095474f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ537478.1:1..276,AJ537479.1:1..276,
FT                   AJ537480.1:1..>117)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2429"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q860B5"
FT                   /db_xref="IMGT/HLA:A*24:29"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q860B5"
FT                   /protein_id="CAD61024.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETRKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQPTV
FT                   PIVGIIAGLVLLGAVITGAVVAAVMWRRNSS"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2429"
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 85 C; 94 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac acggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//