spacer

EBI Dbfetch

ID   AJ536121; SV 1; linear; mRNA; STD; HUM; 810 BP.
XX
AC   AJ536121;
XX
DT   13-FEB-2003 (Rel. 74, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens mRNA for MHC class II antigen (HLA-DRB1 gene), HLA-DRB1*0409
DE   allele
XX
KW   HLA-DRB1 gene; HLA-DRB1*0409 allele; human leucocyte antigen;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-810
RA   Vilches C.;
RT   ;
RL   Submitted (08-JAN-2003) to the INSDC.
RL   Vilches C., Immunologia, Hospital Universitario Puerta de Hierro, San
RL   Martin de Porres 4, 28035 Madrid, SPAIN.
XX
RN   [3]
RX   DOI; 10.1111/j.1399-0039.2005.00407.x.
RX   PUBMED; 15896200.
RA   Vilches C., Sepulveda S., Balas A., Solis R., Aviles M.J., Estefania E.,
RA   Gomez-Lozano N., Vicario J.L., DePablo R.;
RT   "Complete coding sequences and haplotypic associations of HLA-B*0707,
RT   -B*1524, -B*4405, -B*4802, -DRB1*0409, -DRB1*0411, -DRB1*1115, -DRB1*1305,
RT   and the novel allele -DRB1*0709. Group-specific amplification of cDNA from
RT   DRB1 alleles associated to DRB3 and DRB4";
RL   Tissue Antigens 65(6):529-538(2005).
XX
DR   MD5; 407385fd4ebd2a770cdf772780625ea8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..810
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="LC284"
FT                   /tissue_type="peripheral blood mononuclear cells"
FT                   /db_xref="taxon:9606"
FT   CDS             10..810
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0409"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q860C0"
FT                   /db_xref="H-InvDB:HIT000248559_03.4"
FT                   /db_xref="IMGT/HLA:DRB1*04:09"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q860C0"
FT                   /protein_id="CAD60087.1"
FT                   /translation="MVCLKFPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEQVKHECH
FT                   FFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKDLLEQKRAAV
FT                   DTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
FT   sig_peptide     10..96
FT                   /gene="HLA-DRB1"
FT   mat_peptide     97..807
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
XX
SQ   Sequence 810 BP; 174 A; 211 C; 259 G; 166 T; 0 other;
     ttctccagca tggtgtgtct gaagttccct ggaggctcct gcatggcagc tctgacagtg        60
     acactgatgg tgctgagctc cccactggct ttggctgggg acacccgacc acgtttcttg       120
     gagcaggtta aacatgagtg tcatttcttc aacgggacgg agcgggtgcg gttcctggac       180
     agatacttct atcaccaaga ggagtacgtg cgcttcgaca gcgacgtggg ggagtaccgg       240
     gcggtgacgg agctggggcg gcctagcgcc gagtactgga acagccagaa ggacctcctg       300
     gagcagaagc gggccgcggt ggacacctac tgcagacaca actacggggt tggtgagagc       360
     ttcacagtgc agcggcgagt ctatcctgag gtgactgtgt atcctgcaaa gacccagccc       420
     ctgcagcacc acaacctcct ggtctgctct gtgaatggtt tctatccagg cagcattgaa       480
     gtcaggtggt tccggaacgg ccaggaagag aagactgggg tggtgtccac aggcctgatc       540
     cagaatggag actggacctt ccagaccctg gtgatgctgg aaacagttcc tcggagtgga       600
     gaggtttaca cctgccaagt ggagcaccca agcctgacga gccctctcac agtggaatgg       660
     agagcacggt ctgaatctgc acagagcaag atgctgagtg gagtcggggg cttcgtgctg       720
     ggcctgctct tccttggggc cgggctgttc atctacttca ggaatcagaa aggacactct       780
     ggacttcagc caacaggatt cctgagctga                                        810
//


spacer
spacer