spacer

EBI Dbfetch

ID   AJ535690; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ535690;
XX
DT   04-SEP-2003 (Rel. 77, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-Cw gene for human leukocyte antigen, HLA-Cw*14
DE   allele, exon 2 and joined CDS
XX
KW   HLA-Cw gene; HLA-Cw*14 allele; human leukocyte antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   De Canck I.;
RT   ;
RL   Submitted (17-DEC-2002) to the INSDC.
RL   De Canck I., Humane Gentica, Innogenetics, Technologiepark 6, 9052
RL   Zwijnaarde, BELGIUM.
XX
RN   [2]
RA   Canck I.;
RT   "Identification of a new HLA Cw*14 allele by INNO LiPA";
RL   Unpublished.
XX
DR   MD5; fdb1bd2a0662ff46bdb1ff6ae1f7be25.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ535691.2:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*14"
FT                   /product="human leukocyte antigen"
FT                   /db_xref="GOA:Q546E2"
FT                   /db_xref="IMGT/HLA:C*14:02:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q546E2"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAD59685.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMFGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   sig_peptide     join(<1..270,AJ535691.2:1..272)
FT                   /gene="HLA-Cw"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*14"
FT                   /number=2
XX
SQ   Sequence 270 BP; 53 A; 84 C; 98 G; 35 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer