Dbfetch

ID   AJ535113; SV 1; linear; mRNA; STD; HUM; 1110 BP.
XX
AC   AJ535113;
XX
DT   13-FEB-2003 (Rel. 74, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens mRNA for MHC class I antigen (HLA-B gene), HLA-B*44 allele
XX
KW   HLA-B gene; HLA-B*44 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1110
RA   Vilches C.;
RT   ;
RL   Submitted (13-DEC-2002) to the INSDC.
RL   Vilches C., Inmunologia, Hospital Universitario Puerta de Hierro, San
RL   Martin de Porres 4, 28035 Madrid, SPAIN.
XX
RN   [3]
RX   DOI; 10.1111/j.1399-0039.2005.00407.x.
RX   PUBMED; 15896200.
RA   Vilches C., Sepulveda S., Balas A., Solis R., Aviles M.J., Estefania E.,
RA   Gomez-Lozano N., Vicario J.L., DePablo R.;
RT   "Complete coding sequences and haplotypic associations of HLA-B*0707,
RT   -B*1524, -B*4405, -B*4802, -DRB1*0409, -DRB1*0411, -DRB1*1115, -DRB1*1305,
RT   and the novel allele -DRB1*0709. Group-specific amplification of cDNA from
RT   DRB1 alleles associated to DRB3 and DRB4";
RL   Tissue Antigens 65(6):529-538(2005).
XX
DR   MD5; 0ca11a039dcb19ff02dc5faef7042476.
DR   Ensembl-Gn; ENSG00000228964; homo_sapiens.
DR   Ensembl-Tr; ENST00000421349; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1110
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /country="Spain"
FT                   /cell_line="HSV33"
FT                   /cell_type="peripheral blood mononuclear cells"
FT                   /db_xref="taxon:9606"
FT   CDS             5..1093
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P30481"
FT                   /db_xref="H-InvDB:HIT000248534_03.4"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*44:05:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1M6O"
FT                   /db_xref="PDB:1N2R"
FT                   /db_xref="PDB:1SYS"
FT                   /db_xref="PDB:1SYV"
FT                   /db_xref="PDB:3DX6"
FT                   /db_xref="PDB:3DX7"
FT                   /db_xref="PDB:3DX8"
FT                   /db_xref="PDB:3DXA"
FT                   /db_xref="PDB:3KPL"
FT                   /db_xref="PDB:3KPM"
FT                   /db_xref="PDB:3KPN"
FT                   /db_xref="PDB:3KPO"
FT                   /db_xref="PDB:3KPP"
FT                   /db_xref="PDB:3KPQ"
FT                   /db_xref="PDB:3KPR"
FT                   /db_xref="PDB:3KPS"
FT                   /db_xref="PDB:3L3D"
FT                   /db_xref="PDB:3L3G"
FT                   /db_xref="PDB:3L3I"
FT                   /db_xref="PDB:3L3J"
FT                   /db_xref="PDB:3L3K"
FT                   /db_xref="PDB:4JQX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30481"
FT                   /protein_id="CAD59381.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   VTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   sig_peptide     5..76
FT                   /gene="HLA-B"
FT   mat_peptide     77..1090
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
XX
SQ   Sequence 1110 BP; 229 A; 339 C; 367 G; 175 T; 0 other;
     cgagatgcgg gtcacggcgc cccgaaccct cctcctgctg ctctgggggg cagtggccct        60
     gaccgagacc tgggccggct cccactccat gaggtatttc tacaccgcca tgtcccggcc       120
     cggccgcggg gagccccgct tcatcaccgt gggctacgtg gacgacacgc tgttcgtgag       180
     gttcgacagc gacgccacga gtccgaggaa ggagccgcgg gcgccatgga tagagcagga       240
     ggggccggag tattgggacc gggagacaca gatctccaag accaacacac agacttaccg       300
     agagaacctg cgcaccgcgc tccgctacta caaccagagc gaggccgggt ctcacatcat       360
     ccagaggatg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg ggtatgacca       420
     gtacgcctac gacggcaagg attacatcgc cctgaacgag gacctgagct cctggaccgc       480
     ggcggacacc gcggctcaga tcacccagcg caagtgggag gcggcccgtg tggcggagca       540
     ggacagagcc tacctggagg gcctgtgcgt ggagtcgctc cgcagatacc tggagaacgg       600
     gaaggagacg ctgcagcgcg cggacccccc aaagacacat gtgacccacc accccatctc       660
     tgaccatgag gtcaccctga ggtgctgggc cctgggcttc taccctgcgg agatcacact       720
     gacctggcag cgggatggcg aggaccaaac tcaggacacc gagcttgtgg agaccagacc       780
     agcaggagat agaaccttcc agaagtgggc agctgtggtg gtgccttctg gagaagagca       840
     gagatacaca tgccatgtac agcatgaggg gctgccgaag cccctcaccc tgagatggga       900
     gccgtcttcc cagtccaccg tccccatcgt gggcattgtt gctggcctgg ctgtcctagc       960
     agttgtggtc atcggagctg tggtcgctgc tgtgatgtgt aggaggaaga gctcaggtgg      1020
     aaaaggaggg agctactctc aggctgcgtg cagcgacagt gcccagggct ctgatgtgtc      1080
     tctcacagct tgaaaagcct gagacagctg                                       1110
//