spacer

EBI Dbfetch

ID   AJ534885; SV 1; linear; genomic DNA; STD; HUM; 301 BP.
XX
AC   AJ534885;
XX
DT   17-DEC-2002 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen,
DE   HLA-DRB1*1104variant allele
XX
KW   HLA-DRB1 gene; HLA-DRB1*1104variant allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-301
RA   Hepkema B.G.;
RT   ;
RL   Submitted (11-DEC-2002) to the INSDC.
RL   Hepkema B.G., Transplantation Immunology, University Hospital Groningen,
RL   P.O.box 30 001, 9700 RB Groningen, NETHERLANDS.
XX
RN   [2]
RA   Hepkema B.G., Lems S.P.M., Jongsma T.;
RT   "Identification of a new HLA-DRB1 allele";
RL   Unpublished.
XX
DR   MD5; c5b21e0f8a40516a6209befce6db719b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..301
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type=" peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <19..>288
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1104variant"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8HWG3"
FT                   /db_xref="IMGT/HLA:DRB1*11:46:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWG3"
FT                   /protein_id="CAD59236.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 301 BP; 60 A; 74 C; 109 G; 58 T; 0 other;
     tcgttcgtgt ccccacagca cgtttcttgg agtactctac gtctgagtgt catttcttca        60
     atgggacgga gcgggtgcgg ttcctggaca gatacttcca taaccaggag gagtacgtgc       120
     gcttcgacag cgacgtgggg gagttccggg cggtgacgga gctggggcgg cctgatgagg       180
     agtactggaa cagccagaag gacttcctgg aagacaggcg ggccgcggtg gacacctact       240
     gcagacacaa ctacggggtt gtggagagct tcacagtgca gcggcgaggt gagcgcggcg       300
     c                                                                       301
//


spacer
spacer