Dbfetch

ID   AJ515905; SV 2; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ515905;
XX
DT   12-FEB-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens partial HLA-D gene for MHC class II antigen, HLA-DRB1* allele,
DE   exon 2
XX
KW   HLA-D gene; HLA-DRB1* allele; human leucocyte antigen D;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by author [02-DEC-2002]
RP   1-270
RA   Vidal S.;
RT   ;
RL   Submitted (12-NOV-2002) to the INSDC.
RL   Vidal S., Immunology, Institut Recerca Hospital Sant Pau, pare claret 167,
RL   08025, SPAIN.
XX
RN   [2]
RA   Morante M., Vidal S., Mosquera A., Querol S., Garcia J.,
RA   Rodriguez-Sanchez J.L.;
RT   "DRB1 alleles with variations at annealing sites of commonly used
RT   amplification primers for SBT";
RL   Unpublished.
XX
DR   MD5; 94a5782b1c02e497ad5d1824f1d15281.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-D"
FT                   /allele="HLA-DRB1*"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q860Z2"
FT                   /db_xref="IMGT/HLA:DRB1*14:46"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q860Z2"
FT                   /protein_id="CAD56693.2"
FT                   /translation="RFLELRKSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-D"
FT                   /allele="HLA-DRB1*"
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 64 C; 101 G; 48 T; 0 other;
     cacgtttctt ggagctgcgt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//