Dbfetch

ID   AJ514940; SV 1; linear; genomic DNA; STD; HUM; 552 BP.
XX
AC   AJ514940;
XX
DT   30-JUN-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for new HLA-B allele, exons 3-4
XX
KW   HLA-B gene; human leucocyte antigen B; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-552
RA   Czachurski D.;
RT   ;
RL   Submitted (30-OCT-2002) to the INSDC.
RL   Czachurski D., Department of Transplantation Immunology, University of
RL   Heidelberg, Im Neuenheimer Feld 305, D-69120, GERMANY.
XX
RN   [2]
RA   Czachurski D.R., Opelz G., Mytilineos J.;
RT   "A new HLA-B allele found in a Caucasian individual of iranian origin";
RL   Unpublished.
XX
RN   [3]
RA   Czachurski D.R.;
RT   "Hochaufloesende HLA-Klasse I und II Typisierung mittels Sequenzanalyse.
RT   Einfluss auf das Transplantatueberleben.";
RL   Unpublished.
XX
DR   MD5; 89b61b65c09a0d66eddb3f7355b48cbb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..552
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q"
FT                   /host="R24503"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany:Nord-Baden"
FT                   /pop_variant="Iranian Caucasian"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..276,277..552)
FT                   /gene="HLA-B"
FT                   /allele="new HLA-B allele"
FT   CDS             join(<1..276,277..>552)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="new HLA-B allele"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*56:11"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YPH5"
FT                   /protein_id="CAD55950.1"
FT                   /translation="SHIIQRMYGCDLGPDGRLLRGHDQFAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPIS
FT                   DHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEE
FT                   QRYTCHVQHEGLPKPLTLRW"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /allele="new HLA-B allele"
FT                   /number=3
FT   intron          276..277
FT                   /gene="HLA-B"
FT                   /allele="new"
FT                   /number=3
FT   exon            277..552
FT                   /gene="HLA-B"
FT                   /allele="new HLA-B allele"
FT                   /number=4
XX
SQ   Sequence 552 BP; 120 A; 169 C; 183 G; 80 T; 0 other;
     ggtctcacat catccagagg atgtatggct gcgacctggg gcccgacggg cgcctcctcc        60
     gcgggcatga ccagttcgcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgtggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcggaccc cccaaagaca cacgtgaccc       300
     accaccccat ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg       360
     cggagatcac actgacctgg cagcgggatg gcgaggacca aactcaggac actgagcttg       420
     tggagaccag accagcagga gatagaacct tccagaagtg ggcagctgtg gtggtgcctt       480
     ctggagaaga gcagagatac acatgccatg tacagcatga ggggctgccg aagcccctca       540
     ccctgagatg gg                                                           552
//