spacer

EBI Dbfetch

ID   AJ514939; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ514939;
XX
DT   30-JUN-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for new HLA-B allele, exon 2
XX
KW   HLA-B gene; human leucocyte antigen B; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Czachurski D.;
RT   ;
RL   Submitted (30-OCT-2002) to the INSDC.
RL   Czachurski D., Department of Transplantation Immunology, University of
RL   Heidelberg, Im Neuenheimer Feld 305, D-69120, GERMANY.
XX
RN   [2]
RA   Czachurski D.R., Opelz G., Mytilineos J.;
RT   "A new HLA-B allele found in a Caucasian individual of iranian origin";
RL   Unpublished.
XX
RN   [3]
RA   Czachurski D.R.;
RT   "Hochaufloesende HLA-Klasse I und II Typisierung mittels Sequenzanalyse.
RT   Einfluss auf das Transplantatueberleben.";
RL   Unpublished.
XX
DR   MD5; 3dbc079d336042674941fa4f90c45e33.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q"
FT                   /host="R24503"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany:Nord-Baden"
FT                   /pop_variant="Iranian Caucasian"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            1..270
FT                   /gene="HLA-B"
FT                   /allele="new HLA-B allele"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="new HLA-B allele"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q7YPH6"
FT                   /db_xref="IMGT/HLA:B*56:11"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YPH6"
FT                   /protein_id="CAD55949.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="new HLA-B allele"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 85 C; 93 G; 34 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer