spacer

EBI Dbfetch

ID   AJ512947; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ512947;
XX
DT   26-OCT-2002 (Rel. 73, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*11
DE   allele  exon 2
XX
KW   HLA-DRB1 gene; human leucocyte antigen D; major histocompatibility complex;
KW   MHC class II antigen HLA-DRB1*11 allele.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Nesci S.;
RT   ;
RL   Submitted (24-OCT-2002) to the INSDC.
RL   Nesci S., Onco Ematologia, Laboratorio di Ricerca OncoEmatologico, Via
RL   Lombroso, 61100 PESARO, ITALY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2004.00176.x.
RX   PUBMED; 14989721.
RA   Buffi O., Iliescu A., Andreani M., Nesci S.;
RT   "A new HLA-DRB1*11 allele, DRB1*1144, identified by cloning and
RT   sequencing";
RL   Tissue Antigens 63(3):282-283(2004).
XX
DR   MD5; 2a9610f93ce96d1597574a1d2c9a51a2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8HWL8"
FT                   /db_xref="IMGT/HLA:DRB1*11:44"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWL8"
FT                   /protein_id="CAD55599.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYARFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 63 C; 97 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer