spacer

EBI Dbfetch

ID   AJ511650; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ511650;
XX
DT   10-APR-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*5106 allele,
DE   exon 2 and joined CDS
XX
KW   HLA-B gene; HLA-B*5106 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Gervais T.G.;
RT   ;
RL   Submitted (10-OCT-2002) to the INSDC.
RL   Gervais T.G., Immunohaematology, UCL Cliniques St Luc, Clos
RL   Chapelle-aux-Champs, 30 PO Box 3052, Brussels, 1200, BELGIUM.
XX
RN   [2]
RA   Gervais T.G., Latinne D.;
RT   "Confirmatory typing for the HLA-B*5106 gene obtained by sequence based
RT   typing";
RL   Unpublished.
XX
DR   MD5; 36f4d0dfd129d13cf958dd848a3ffe80.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="29130"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5106"
FT                   /number=2
FT   CDS             join(<1..270,AJ511651.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5106"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q860Q9"
FT                   /db_xref="IMGT/HLA:B*51:06:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q860Q9"
FT                   /protein_id="CAD54119.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRA"
XX
SQ   Sequence 270 BP; 60 A; 88 C; 84 G; 38 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcattgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer