spacer

EBI Dbfetch

ID   AJ509160; SV 1; linear; genomic DNA; STD; HUM; 314 BP.
XX
AC   AJ509160;
XX
DT   02-OCT-2002 (Rel. 73, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, novel HLA-B*35 allele,
DE   exon 2 and joined CDS
XX
KW   HLA-B gene; HLA-B*35 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-314
RA   Bengtsson M.;
RT   ;
RL   Submitted (27-SEP-2002) to the INSDC.
RL   Bengtsson M., Dept of Clinical Immunology, Rudbeck Laboratory, University
RL   Hospital, S-751 85 Uppsala, SWEDEN.
XX
RN   [2]
RA   Bengtsson M., Persson U., Olerup O.;
RT   "Novel HLA B*35 allele";
RL   Unpublished.
XX
DR   MD5; b4dad8df524ae4d303855bb8ae099b50.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..314
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..39
FT                   /gene="HLA-B"
FT                   /number=1
FT   CDS             join(<40..309,AJ509161.1:2..>277)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="novel HLA-B*35"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q8HWM1"
FT                   /db_xref="IMGT/HLA:B*35:45"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWM1"
FT                   /protein_id="CAD50589.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQRRAYLEGLC
FT                   VESLRRYLENGKETLQRA"
FT   exon            40..309
FT                   /gene="HLA-B"
FT                   /allele="novel HLA-B*35"
FT                   /number=2
FT   intron          310..>314
FT                   /gene="HLA-B"
FT                   /number=2
XX
SQ   Sequence 314 BP; 65 A; 104 C; 103 G; 42 T; 0 other;
     aggagggtcg ggcgggtctc agcccctcct cgcccccagg ctcccactcc atgaggtatt        60
     tctacaccgc catgtcccgg cccggccgcg gggagccccg cttcatcgca gtgggctacg       120
     tggacgacac ccagttcgtg aggttcgaca gcgacgccgc gagtccgagg acggagcccc       180
     gggcgccatg gatagagcag gaggggccgg agtattggga ccggaacaca cagatcttca       240
     agaccaacac acagacttac cgagagagcc tgcggaacct gcgcggctac tacaaccaga       300
     gcgaggccgg tgag                                                         314
//


spacer
spacer