spacer

EBI Dbfetch

ID   AJ508388; SV 1; linear; genomic DNA; STD; HUM; 234 BP.
XX
AC   AJ508388;
XX
DT   19-MAR-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*1416
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*1416 allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-234
RA   Gervais T.G.;
RT   ;
RL   Submitted (18-SEP-2002) to the INSDC.
RL   Gervais T.G., Immunohaematology, UCL Cliniques St Luc, Clos
RL   Chapelle-aux-Champs 30, PO box 3052, Brussels, 1200, BELGIUM.
XX
RN   [2]
RA   Gervais T.G., Latinne D.;
RT   "Confirmatory typing for exon 2 of HLA-DRB1*1416 gene, obtained by
RT   sequence-based typing";
RL   Unpublished.
XX
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..234
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="18573"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>234
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1416"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:16"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="CAD48196.1"
FT                   /translation="ECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGRPAA
FT                   EHWNSQKDILEDERAAVDTYCRHNYGVVESFTV"
FT   exon            <1..>234
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1416"
FT                   /number=2
XX
SQ   Sequence 234 BP; 50 A; 56 C; 88 G; 40 T; 0 other;
     gagtgtcatt tcttcaatgg gacggagcgg gtgcggttcc tggacagata cttccataac        60
     caggaggagt tcgtgcgctt cgacagcgac gtgggggagt accgggcggt gacggagctg       120
     gggcggcctg ctgcggagca ctggaacagc cagaaggaca tcctggaaga cgagcgggcc       180
     gcggtggaca cctactgcag acacaactac ggggttgtgg agagcttcac agtg             234
//


spacer
spacer