Dbfetch

ID   AJ507800; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   AJ507800;
XX
DT   19-SEP-2002 (Rel. 73, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*38new
DE   allele, exons 2-3
XX
KW   HLA-B gene; HLA-B*38new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Witter K.;
RT   ;
RL   Submitted (12-SEP-2002) to the INSDC.
RL   Witter K., Lab of Immunogenetics, University of Munich, Paul-Heyse Strasse
RL   33, 80336 Munich, GERMANY.
XX
RN   [2]
RA   Witter K., Lau M., Albert E.D.;
RT   "A novel HLA-B allele detected through the Terasaki Cell Exchange for HLA
RT   typing quality control";
RL   Unpublished.
XX
DR   MD5; 254901d65a438a5fbb7983794b444cc4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,517..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="similar to HLA-B*3801 allele"
FT                   /db_xref="GOA:Q8HWM3"
FT                   /db_xref="IMGT/HLA:B*38:09"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWM3"
FT                   /protein_id="CAD47828.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQICKTNTQTYRENLRIALRYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQFAYDGKDYIALNEDLSSWTAAETAAQITQRKWEAARVAEQLRTYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT                   /number=2
FT   intron          271..516
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT                   /number=2
FT   variation       483
FT                   /replace="c"
FT   exon            517..>791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*38new"
FT                   /number=3
XX
SQ   Sequence 791 BP; 144 A; 262 C; 280 G; 105 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gaatattggg       180
     accggaacac acagatctgc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcggggggac ggggctgacc gcggggccgg ggccagggtc tcacaccctc cagaggatgt       540
     acggctgcga cgtggggccg gacgggcgcc tcctccgcgg gcataaccag ttcgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgagctc ctggaccgcg gcggagaccg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtgt ggcggagcag ctgagaacct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc g                                                            791
//