Dbfetch

ID   AJ507651; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ507651;
XX
DT   21-SEP-2002 (Rel. 73, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*52 allele,
DE   exon 2 and joined CDS
XX
KW   HLA-B gene; HLA-B*52 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lebedeva T.V.;
RT   ;
RL   Submitted (10-SEP-2002) to the INSDC.
RL   Lebedeva T.V., HLA laboratory, American Red Cross New England Region, 180
RL   Rustcraft Rd, Dedham, MA 02026, USA.
XX
RN   [2]
RA   Lebedeva T.V., Huang A., Janzen M., Yu N.;
RT   "Identification of novel HLA Class I alleles using single allele
RT   sequencing";
RL   Unpublished.
XX
DR   MD5; cbbbe1732c8ae304e4f39e9402fd6950.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ507652.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*52:01:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWN9"
FT                   /protein_id="CAD48119.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 87 C; 86 G; 38 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcattgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ttgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//