spacer

EBI Dbfetch

ID   AJ507645; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ507645;
XX
DT   21-SEP-2002 (Rel. 73, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*24 allele,
DE   exon 2 and joined CDS
XX
KW   HLA-A gene; HLA-A*24 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lebedeva T.V.;
RT   ;
RL   Submitted (10-SEP-2002) to the INSDC.
RL   Lebedeva T.V., HLA laboratory, American Red Cross New England Region, 180
RL   Rustcraft Rd, Dedham, MA 02026, USA.
XX
RN   [2]
RA   Lebedeva T.V., Huang A., Janzen M., Yu N.;
RT   "Identification of novel HLA Class I alleles using single allele
RT   sequencing";
RL   Unpublished.
XX
DR   MD5; be2e622cf2fa0d79e09a306bec411dba.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ507646.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8HWP2"
FT                   /db_xref="IMGT/HLA:A*24:38"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWP2"
FT                   /protein_id="CAD48116.1"
FT                   /translation="SHSMSYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24"
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 85 C; 94 G; 36 T; 0 other;
     gctcccactc catgagctat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer