Dbfetch

ID   AJ507432; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ507432;
XX
DT   05-OCT-2002 (Rel. 73, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw variant,
DE   exon 3
XX
KW   HLA-C gene; HLA-Cw variant allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Day S.;
RT   ;
RL   Submitted (05-SEP-2002) to the INSDC.
RL   Day S., H and I DNA Reference Laboratory, National Blood Service, Southmead
RL   Rd, BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Collins N.;
RT   "Identification of a novel HLA-Cw allele";
RL   Unpublished.
XX
DR   MD5; 7fd61bca30258bb5f160d4bfe765b0d6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:C*12:09"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWP3"
FT                   /protein_id="CAD45558.1"
FT                   /translation="SHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAA
FT                   DTAAQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRA"
FT   exon            <1..>276
FT                   /gene="HLA-C"
FT                   /number=3
XX
SQ   Sequence 276 BP; 51 A; 88 C; 102 G; 35 T; 0 other;
     ggtctcacac cctccagtgg atgtatggct gcgacctggg gcccgacggg cgcctcctcc        60
     gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//