Dbfetch

ID   AJ507382; SV 1; linear; genomic DNA; STD; HUM; 234 BP.
XX
AC   AJ507382;
XX
DT   04-MAR-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*1306
DE   allele, exon 2, isolate 26481
XX
KW   HLA-DRB1 gene; HLA-DRB1*1306 allele; human leucocyte antigen;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-234
RA   Gervais T.G.;
RT   ;
RL   Submitted (04-SEP-2002) to the INSDC.
RL   Gervais T.G., Immunohaematology, UCL Cliniques St Luc, 30 Clos
RL   Chapelle-aux-Champs, PO Box 3052, 1200 Brussels, BELGIUM.
XX
RN   [2]
RA   Gervais T.G., Auspert R., Latinne D.;
RT   "Confirmatory sequence for the HLA-DRB1*1306 gene, obtained by sequence
RT   based typing";
RL   Unpublished.
XX
DR   MD5; f6ba341225dcd2e30120a36e29560944.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..234
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="26481"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>234
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1306"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q860S1"
FT                   /db_xref="IMGT/HLA:DRB1*13:06"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q860S1"
FT                   /protein_id="CAD45639.1"
FT                   /translation="ECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVTELGRPDA
FT                   EYWNSQKDILEDRRAAVDTYCRHNYGVVESFTV"
FT   exon            <1..>234
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1306"
FT                   /number=2
XX
SQ   Sequence 234 BP; 52 A; 55 C; 87 G; 40 T; 0 other;
     gagtgtcatt tcttcaatgg gacggagcgg gtgcggttcc tggacagata cttccataac        60
     caggaggaga acgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       120
     gggcggcctg atgccgagta ctggaacagc cagaaggaca tcctggaaga caggcgggcc       180
     gcggtggaca cctactgcag acacaactac ggggttgtgg agagcttcac agtg             234
//