spacer

EBI Dbfetch

ID   AJ507156; SV 1; linear; genomic RNA; STD; VRL; 1341 BP.
XX
AC   AJ507156;
XX
DT   02-NOV-2002 (Rel. 73, Created)
DT   05-NOV-2002 (Rel. 73, Last updated, Version 2)
XX
DE   Hepatitis C virus partial gene for polyprotein, genomic RNA, isolate ETR2
XX
KW   non-structural protein 5A; polyprotein.
XX
OS   Hepatitis C virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae;
OC   Hepacivirus.
XX
RN   [1]
RP   1-1341
RX   DOI; 10.1128/JVI.76.21.11079-11090.2002.
RX   PUBMED; 12368350.
RA   Sarrazin C., Herrmann E., Bruch K., Zeuzem S.;
RT   "Hepatitis C virus nonstructural 5A protein and interferon resistance: a
RT   new model for testing the reliability of mutational analyses";
RL   J. Virol. 76(21):11079-11090(2002).
XX
RN   [2]
RP   1-1341
RA   Sarrazin C.;
RT   ;
RL   Submitted (02-JUL-2002) to the INSDC.
RL   University Clinic des Saarlandes, Klinik Innere Medizin II, Kirrberger
RL   Str., Homburg / Saar D-66421, Germany.
XX
DR   MD5; 33e2a01df3bca34ff4e95497c15df031.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1341
FT                   /organism="Hepatitis C virus"
FT                   /isolate="ETR2"
FT                   /mol_type="genomic RNA"
FT                   /isolation_source="Human patient, end-of-treatment response
FT                   and relapse"
FT                   /db_xref="taxon:11103"
FT   CDS             <1..>1341
FT                   /codon_start=1
FT                   /product="polyprotein"
FT                   /db_xref="GOA:Q8B0G3"
FT                   /db_xref="InterPro:IPR002868"
FT                   /db_xref="InterPro:IPR013192"
FT                   /db_xref="InterPro:IPR013193"
FT                   /db_xref="InterPro:IPR024350"
FT                   /db_xref="UniProtKB/TrEMBL:Q8B0G3"
FT                   /protein_id="CAD45200.1"
FT                   /translation="SGSWLRDIWDWICTVLSDFKTWLQSKLLPRLPGVPFLSCQRGYKG
FT                   VWRGDGIMQTTCPCGAQIAGHVKNGSMRIVGPRTCSNTWHGTFPINAYTTGPCTPSPAP
FT                   NYSRALWRVAAEEYVEVTRVGDFHYVTGMTTDNVKCPCQVPAPEFFTEVDGVRLHRYAP
FT                   ACKPLLREEVTFLVGLNQYLVGSQLPCEPEPDVAVLTSMLTDPSHITAETAARRLARGS
FT                   PPSLASSSASQLSAPSLKATCTTHHDSPDADLIEANLLWRQEMGGNITRVESENKVVIL
FT                   DSFDPLRAEEDEREVSVPAEILRKSRKFPPALPIWARPDYNPPLLESWKDPDYAPPVVH
FT                   GCPLPPTKAPPIPPPRRKRTIVLTESTVSSALAELATKTFGSSESSAVDSGTATAPPDQ
FT                   LPDNGDTGSDAESYSSMPPLEGEPGDPDLSDGSWSTMSEEASEDVVCC"
FT   mat_peptide     1..1341
FT                   /product="non-structural protein 5A"
XX
SQ   Sequence 1341 BP; 272 A; 421 C; 392 G; 256 T; 0 other;
     tccggctctt ggctaaggga tatctgggac tggatatgca cggtgttgag tgacttcaag        60
     acctggctcc aatccaagct cctgccgcgg ttaccgggag tccccttcct ctcgtgccaa       120
     cgtgggtata agggggtttg gcggggagac ggcatcatgc aaaccacctg cccatgtgga       180
     gcacaaatcg ccggacatgt caaaaacggt tccatgagga tcgttgggcc tagaacctgc       240
     agcaacacgt ggcacggaac attccccatc aacgcataca ccactggccc ctgcacaccc       300
     tccccggcgc caaactattc cagggcgctg tggcgggtag ctgctgagga gtacgtggag       360
     gttacgcggg tgggggattt ccactacgtg acgggcatga ccactgacaa cgtaaagtgc       420
     ccatgccagg ttccggcccc cgagtttttc acagaagtgg atggggtgcg gctgcacagg       480
     tacgctccag cgtgcaaacc cctcctacgg gaggaggtta cattcctggt cgggctcaac       540
     cagtatttgg ttgggtcaca gctcccatgt gagcccgaac cggacgtagc agtgctcacc       600
     tccatgctca ccgacccctc ccacattacg gcggagacgg ccgcgcgtag gctggccagg       660
     gggtctcccc cctccttggc cagctcttca gccagccagt tgtctgcgcc ctccttgaag       720
     gcgacatgca ctacccatca tgactccccg gacgctgacc taattgaggc caaccttctg       780
     tggcggcagg agatgggcgg gaacatcacc cgcgtggagt cagaaaacaa ggtagtaatt       840
     ctggactctt ttgacccgct tcgagcggag gaggatgaga gggaagtatc cgttccggcg       900
     gagatcctgc ggaaatccag gaaattcccc ccagcgctgc ccatatgggc acgcccggat       960
     tacaatcccc cactgctaga gtcctggaag gacccggact atgcccctcc ggtggtgcac      1020
     gggtgcccat tgccacctac caaggcccct ccaataccac ctccacggag gaagaggacg      1080
     atagtcctga cagaatctac cgtgtcttct gccctggcgg agcttgctac gaagaccttt      1140
     ggcagctccg aatcgtcggc cgtcgacagc ggcacggcga ccgcccctcc tgaccagctc      1200
     cccgacaatg gtgacacagg gtccgacgct gagtcgtatt cttccatgcc cccccttgag      1260
     ggggaaccgg gggaccccga tcttagcgac gggtcttggt ctaccatgag cgaggaggct      1320
     agtgaggacg tcgtctgctg t                                                1341
//


spacer
spacer