spacer

EBI Dbfetch

ID   AJ507155; SV 1; linear; genomic RNA; STD; VRL; 1341 BP.
XX
AC   AJ507155;
XX
DT   02-NOV-2002 (Rel. 73, Created)
DT   06-NOV-2002 (Rel. 73, Last updated, Version 3)
XX
DE   Hepatitis C virus partial gene for polyprotein, genomic RNA, isolate ETR1
XX
KW   non-structural protein 5A; polyprotein.
XX
OS   Hepatitis C virus
OC   Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage;
OC   Flaviviridae; Hepacivirus.
XX
RN   [1]
RP   1-1341
RX   DOI; 10.1128/JVI.76.21.11079-11090.2002.
RX   PUBMED; 12368350.
RA   Sarrazin C., Herrmann E., Bruch K., Zeuzem S.;
RT   "Hepatitis C virus nonstructural 5A protein and interferon resistance: a
RT   new model for testing the reliability of mutational analyses";
RL   J. Virol. 76(21):11079-11090(2002).
XX
RN   [2]
RP   1-1341
RA   Sarrazin C.;
RT   ;
RL   Submitted (02-JUL-2002) to the INSDC.
RL   University Clinic des Saarlandes, Klinik Innere Medizin II, Kirrberger
RL   Str., Homburg / Saar D-66421, Germany.
XX
DR   MD5; 5f5d4e29b8af5f39320b2645c9626e3f.
DR   EuropePMC; PMC136596; 12368350.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1341
FT                   /organism="Hepatitis C virus"
FT                   /isolate="ETR1"
FT                   /mol_type="genomic RNA"
FT                   /isolation_source="Human patient, end-of-treatment response
FT                   and relapse"
FT                   /db_xref="taxon:11103"
FT   CDS             <1..>1341
FT                   /codon_start=1
FT                   /product="polyprotein"
FT                   /db_xref="GOA:Q8B0G4"
FT                   /db_xref="InterPro:IPR002868"
FT                   /db_xref="InterPro:IPR013192"
FT                   /db_xref="InterPro:IPR013193"
FT                   /db_xref="InterPro:IPR024350"
FT                   /db_xref="UniProtKB/TrEMBL:Q8B0G4"
FT                   /protein_id="CAD45199.1"
FT                   /translation="SGSWLRDVWDWICTVLTDFKTWLQSKLLPRLPGVPFFSCQRGYKG
FT                   VWRGDGIMQTTCPCGAQITGHVKNGSMRIAGPKTCSNMWHGTFPINAYTTGPCTPSPAP
FT                   NYSRALWRVAAEEYVEVTRVGDFHYVTGITTDNVKCPCQVPAPEFFTEVDGVRLHRYAP
FT                   ACRPLLREEVSFQVGLNQYLVGSQLPCEPEPDVTVLTSMLTDPSHITAETAKRRLARGS
FT                   PPSLASSSASQLSAPSLKATCTTHHDSPDADLIEANLLWKQEMGGNITRVESENKVVIL
FT                   DSFDPLVAEEDEREISVPAEILRKSRRFTPALPIWARPDYNPPLVETWKKPDYEPPVVH
FT                   GCPLPPPRAPPVPPPRRKRTVVLTESTVSSALAELATKTFGSSGSSAVDSGTATAPPDQ
FT                   SSGDGDAGSDVESYSSMPPLEGEPGDPDLSDGSWSTVSEEASEDVVCC"
FT   mat_peptide     1..1341
FT                   /product="non-structural protein 5A"
XX
SQ   Sequence 1341 BP; 269 A; 414 C; 394 G; 264 T; 0 other;
     tccggctcgt ggctaaggga tgtttgggac tggatatgca cggtgttgac tgatttcaag        60
     acctggctcc agtccaagct tctgccgcgg ctaccgggag tccctttctt ctcatgccaa       120
     cgtgggtaca agggagtctg gcggggagac ggcatcatgc aaaccacctg cccgtgtgga       180
     gcacaaatta ccggacatgt caagaacggc tccatgagga tcgctgggcc taaaacctgt       240
     agcaacatgt ggcatggaac tttccctatc aacgcgtaca ccacgggccc ctgcacaccc       300
     tccccggcgc caaattactc tagggcgctg tggcgagtgg ctgctgagga gtacgtggag       360
     gttacgcgag tgggggattt ccactacgtg acgggcataa ccactgacaa cgtaaaatgc       420
     ccatgccagg ttccggcccc cgaattcttc acagaggtgg atggggtgcg gctgcacagg       480
     tacgctccgg cgtgcaggcc tctcctacgg gaggaggtct cattccaggt cgggctcaac       540
     cagtacctgg ttggatcaca gctcccatgt gagcccgagc cggatgtaac agtgctcact       600
     tccatgctca ccgacccctc ccacattaca gcagagacgg ctaagcgtag gctggccagg       660
     gggtctcccc cctccttggc cagctcctca gctagtcagt tgtctgcgcc ttctttgaag       720
     gcgacatgca ctacccatca tgactccccg gacgctgacc ttattgaggc caacctcctg       780
     tggaagcagg agatgggcgg caacatcacc agggttgagt cagagaacaa agtagtgatt       840
     ctggactcct tcgatccgct tgtggcggag gaggatgagc gggagatctc cgtacccgca       900
     gagatcctgc ggaagtctcg gagattcacc ccggccctgc ccatttgggc acggccggac       960
     tacaaccccc cgctagtaga gacgtggaaa aagcctgact acgaaccacc tgtagtccat      1020
     ggctgcccgc taccacctcc acgggcccct cctgtgcctc cacctcggag aaagaggacg      1080
     gttgtcctga cagaatccac tgtgtcttct gccttggcgg agcttgctac aaagaccttc      1140
     ggcagctccg ggtcgtcggc cgtcgacagc ggcacggcga ccgctcctcc tgaccaatcc      1200
     tccggcgacg gcgacgcagg gtccgacgtt gagtcgtatt cctcaatgcc cccccttgag      1260
     ggagagccgg gggatcccga tctcagcgac gggtcttggt ctaccgtgag cgaggaggcc      1320
     agtgaggacg tagtctgctg c                                                1341
//


spacer
spacer