spacer

EBI Dbfetch

ID   AJ507154; SV 1; linear; mRNA; STD; PLN; 1236 BP.
XX
AC   AJ507154;
XX
DT   05-SEP-2002 (Rel. 73, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Oryza sativa partial mRNA for putative mitogen-activated protein kinase
DE   kinase (mek2 gene)
XX
KW   mek2 gene; mitogen-activated protein kinase kinase.
XX
OS   Oryza sativa (rice)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade;
OC   Ehrhartoideae; Oryzeae; Oryza.
XX
RN   [1]
RP   1-1236
RA   Pu S.;
RT   ;
RL   Submitted (29-AUG-2002) to the INSDC.
RL   Pu S., Department of Biology, National Cheng-Kung University, No. 1
RL   University Rd., Tainan, Taiwan 701, TAIWAN.
XX
RN   [2]
RA   Pu S.Y., Lin W.P., Huang D.D., Huang H.J.;
RT   "The indentification of a novel stress-inducible rice MEK2";
RL   Unpublished.
XX
DR   MD5; ad3aeadb6d5b0d182b61a39ef8605e25.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1236
FT                   /organism="Oryza sativa"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:4530"
FT   CDS             <1..1002
FT                   /codon_start=1
FT                   /gene="mek2"
FT                   /product="putative mitogen-activated protein kinase kinase"
FT                   /db_xref="GOA:Q8L6H0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q8L6H0"
FT                   /protein_id="CAD45180.1"
FT                   /translation="MGKPGKLALPSHESTIGKFLTQSGTFKDGDLLVNKDGLRIVSQSE
FT                   EGEEPLDHNQLSLDDLDAIKVIGKGSSGIVQLVRHKWTGQFFALKVIQLNIQENIRRQI
FT                   AQELKISLSTQCQYVVACCQCFYVNGVISIVLEYMDSGSLSDFLKTVLKGLMYLHHEKH
FT                   IIHRDLKPSNILINHMGEVKISDFGVSAIIASSSAQRDTFTGTYNYMAPERISGQKHGY
FT                   MSDIWSLGLVMLELATGEFPYPPRESFYELLEAVVDHPPPSAPSDQFSEEFCSFVSACI
FT                   QKNASDRSSAQILLNHPFLSMYDDLNIDLASYFTTDGSPLATFNTSNRYDDR"
FT   3'UTR           1003..1236
XX
SQ   Sequence 1236 BP; 339 A; 266 C; 281 G; 350 T; 0 other;
     atggggaagc cggggaagct agcgctgccc tcgcacgagt caaccatcgg caaattcctg        60
     acgcagagcg ggacgttcaa ggacggcgat ctgctcgtca acaaggacgg cctccgcatc       120
     gtctcgcaga gcgaggaagg ggaggaacct ttagatcata atcagttgag tctagatgat       180
     ctagacgcaa tcaaagttat cggtaaaggt agtagtggaa tcgtgcagtt ggttcgccac       240
     aaatggactg gccagttttt tgctctgaag gtaatacaac tcaatatcca ggagaatata       300
     cgcagacaga ttgcgcagga attgaaaatc agcttgtcaa cacagtgcca atatgttgtt       360
     gcatgctgtc agtgttttta cgttaatggt gtcatttcaa ttgttttgga gtatatggac       420
     agtggctctc tctcagattt cctgaagaca gtgctaaaag gactgatgta cttacatcat       480
     gagaagcaca tcatacaccg agatctgaag ccgtcaaata tattaataaa tcatatgggt       540
     gaagtaaaaa tatccgactt tggtgttagt gccatcattg ctagttcctc ggcacaacga       600
     gatacattta ctgggacata taactacatg gcgccagaaa gaatcagtgg gcaaaaacat       660
     ggttatatga gtgatatctg gagcttgggc ctcgttatgc tagaattggc cactggtgaa       720
     tttccatatc ctcctcgtga aagcttttat gaactccttg aagctgttgt cgaccaccca       780
     ccaccttctg ctccatcaga ccagttttca gaggaattct gttcattcgt ctctgcatgt       840
     atccaaaaga atgcttcgga taggtcatct gcacaaatct tattaaatca tccattcctg       900
     agcatgtatg acgacctgaa tatagatctt gcttcgtact tcacaaccga tggatctccg       960
     cttgccacct tcaatacaag caaccgatat gatgacagat agtctgatgc aacactgcgt      1020
     catcatctag ctcgaaggat gatcctttgg ctgtccatct gtagaatcta ccatctacct      1080
     aactggcccc aaatgtttcg tgtatttttt gggagaaaac tttgccctgt gtactgagct      1140
     gggattgatg tctttgatat gtaaatttcg cgtaatttca tatgtagaac aattctagga      1200
     tcattgggca ttgaagtttt gtttgggccg tgcacc                                1236
//


spacer
spacer