spacer

EBI Dbfetch

ID   AJ507153; SV 1; linear; genomic DNA; STD; MAM; 1267 BP.
XX
AC   AJ507153;
XX
DT   18-SEP-2002 (Rel. 73, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Sus scrofa partial PYG gene for glycogen phosphorylase, exons 5-7
XX
KW   glycogen phosphorylase; PYG gene.
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-1267
RA   te Pas M.F.;
RT   ;
RL   Submitted (27-AUG-2002) to the INSDC.
RL   te Pas M.F., Animal Sciences, ID-Lelystad, P.O. Box 65, 8200 AB Lelystad,
RL   NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1046/j.1365-2052.2003.00965_9.x.
RX   PUBMED; 12648107.
RA   te Pas M.F., Leenhouwers J.I., Knol E.F., Booij M., Priem J.,
RA   van der Lende T.;
RT   "Marker polymorphisms in the porcine genes for muscle glycogen synthase
RT   (GYS1) and muscle glycogen phosphorylase (PYGM)";
RL   Anim. Genet. 34(2):157-158(2003).
XX
DR   MD5; 54b185d94576cb8bef8d45fbaffaabdf.
DR   EuropePMC; PMC3204973; 22065995.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1267
FT                   /organism="Sus scrofa"
FT                   /chromosome="2"
FT                   /map="2p17-p14"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9823"
FT   CDS             join(<1..35,866..988,1018..1045)
FT                   /gene="PYG"
FT                   /product="glycogen phosphorylase"
FT                   /note="expressed in muscle"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HYU9"
FT                   /protein_id="CAD47845.1"
FT                   /translation="RGMPGREEDXGCDPVSCPMIPQSFHESRVSSRLCSGQASQLFPIT
FT                   AEWLPRGLPPGILTTA"
FT   exon            <1..35
FT                   /gene="PYG"
FT                   /number=5
FT   intron          36..865
FT                   /gene="PYG"
FT                   /number=5
FT   variation       55
FT                   /gene="PYG"
FT                   /replace="t"
FT                   /note="SNP"
FT   exon            866..988
FT                   /gene="PYG"
FT                   /number=6
FT   intron          989..1017
FT                   /gene="PYG"
FT                   /number=6
FT   exon            1018..1115
FT                   /gene="PYG"
FT                   /number=7
FT   intron          1116..>1267
FT                   /gene="PYG"
FT                   /number=7
XX
SQ   Sequence 1267 BP; 283 A; 337 C; 389 G; 254 T; 4 other;
     agggggatgc cggggagaga ggaggatcmg ggatggggag gggaggaagt tctagasgaa        60
     acagggagaa acagggaaag atcccagagg ctactagacc ctgtgccgtc ttataataga       120
     ggaccccgag gctcacagag cttaacgtga cttcctcgag gtcacacagc tggaaccagg       180
     gagaggctag agacaagatc acaggggagc caggccaagt gcasagcctg ggaggaggag       240
     agaggcttgc tctacccatg ttccttccct gacctggctc ccctccagcc cacaagactc       300
     atcaaagaat agtcacgggc gcttggctcc cctgcacgtc tgacctgggg gctccatagg       360
     aaagaaagcg acagcccaga aatgcggaca ggggagaaaa ttagagcctg cagagggcaa       420
     atgactcact caaggtcatg gagcaagttg gagcctaaag ctaaaccagg tgtctgaatt       480
     ccagctcagc cagtcttctt gctgtggctg ccggtcatcg gcttccagat ggctgcacag       540
     aaagctctag tctttcagaa tcgagagtga gagtcattct gctgtcatcc tcgctaaggt       600
     ccagcagggc actggctgcc cacctggctg tattctctca gggcagcccc ttcccactct       660
     gagctgcagt ttgcactctg ctccaatcag gggctacttc atggtgggga ggggggcgtg       720
     gatgtggccc cgtggtggtg gcagttacta gcaacggttc ctgatgttgg ctaattgtgg       780
     gaggtggggc cagcatcagt cacagttaat tagtccagag gtcaactggt cataaactct       840
     ttgcatggac ttggcttgac ttctgtgacc ctgtcagctg ccccatgatc ccccagtcct       900
     tccatgagtc cagagtgtcc tctagattgt gctcaggcca ggcaagccag ctcttcccca       960
     tcaccgcaga gtggctacca agagggctcc accttgggct ctgggctcac ccctgcctcc      1020
     tcctggaatc ctcacaacag cctagcaagg aggggcaggg aggtggtggt ggtggctctg      1080
     ggatgtcccc tctttatgcg tragatccag ggaggttgag gggttgcttg gggttaccca      1140
     gaattgggac tagaacccgg gactgggagt tggcagaggg caaggacaag gcatggagtt      1200
     ccagctctca gggcctccca gacgcggcag atacccacct cttacaccat gccgggtacc      1260
     ccgcagg                                                                1267
//


spacer
spacer