spacer

EBI Dbfetch

ID   AJ507149; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ507149;
XX
DT   10-SEP-2002 (Rel. 73, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, exon 2 and joined
DE   CDS
XX
KW   HLA-A gene; human leucocyte antigen A; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lebedeva T.V.;
RT   ;
RL   Submitted (29-AUG-2002) to the INSDC.
RL   Lebedeva T.V., HLA laboratory, American Red Cross New England Region, 180
RL   Rustcraft Rd, Dedham, MA 02026, USA.
XX
RN   [2]
RA   Lebedeva T.V., Huang A., Janzen M., Lau M., Reed E., Yu N.;
RT   "Identification of 8 new HLA class I alleles";
RL   Unpublished.
XX
DR   MD5; e7e665aef728ead074532421ee9dd461.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /number=2
FT                   /note="new allele"
FT   mRNA            join(<1..270,AJ507150.1:1..>276)
FT                   /gene="HLA-A"
FT                   /note="new allele"
FT   CDS             join(<1..270,AJ507150.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="new allele"
FT                   /db_xref="GOA:Q8HWQ0"
FT                   /db_xref="IMGT/HLA:A*24:37"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWQ0"
FT                   /protein_id="CAD45178.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   LRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRT"
XX
SQ   Sequence 270 BP; 55 A; 83 C; 95 G; 37 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagctg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer