spacer

EBI Dbfetch

ID   AJ506788; SV 1; linear; genomic DNA; STD; HUM; 226 BP.
XX
AC   AJ506788;
XX
DT   28-AUG-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo Sapiens partial HLA-DRB1 gene for MHC class II antigen, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*0322 allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-226
RA   Anholts J.D.H.;
RT   ;
RL   Submitted (23-AUG-2002) to the INSDC.
RL   Anholts J.D.H., Immunohematology and Bloodtransfusion, Leids Universitair
RL   Medisch Centrum, Albinusdreef 2, 2333 ZA Leiden, NETHERLANDS.
XX
RN   [2]
RA   Anholts J.D.H.;
RT   "Four new HLA alleles found, and conformation of DRB1*0322, DRB1*1433 and
RT   A*3106";
RL   Unpublished.
XX
DR   MD5; c22ef4e89dc7846ad9a9c40aaa971cee.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..226
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>226
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0322"
FT   CDS             <1..>226
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0322"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8MGY2"
FT                   /db_xref="IMGT/HLA:DRB1*03:22"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MGY2"
FT                   /protein_id="CAD44948.1"
FT                   /translation="ECHFFNGTERVRYLDRYFDNQEENVRFDSDVGEFRAVTELGRPDA
FT                   EYWNSQKDLLEQKRGRVDNYCRHNYGVVES"
FT   exon            <1..>226
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0322"
FT                   /number=2
XX
SQ   Sequence 226 BP; 51 A; 51 C; 87 G; 37 T; 0 other;
     tgagtgtcat ttcttcaatg ggacggagcg ggtgcggtac ctggacagat acttcgataa        60
     ccaggaggag aacgtgcgct tcgacagcga cgtgggggag ttccgggcgg tgacggagct       120
     ggggcggcct gatgccgagt actggaacag ccagaaggac ctcctggagc agaagcgggg       180
     ccgggtggac aactactgca gacacaacta cggggttgtg gagagc                      226
//


spacer
spacer